BLASTX nr result
ID: Sinomenium21_contig00023562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00023562 (505 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844609.1| hypothetical protein AMTR_s00016p00218760 [A... 59 9e-07 >ref|XP_006844609.1| hypothetical protein AMTR_s00016p00218760 [Amborella trichopoda] gi|548847080|gb|ERN06284.1| hypothetical protein AMTR_s00016p00218760 [Amborella trichopoda] Length = 1663 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = -3 Query: 176 MATENVDPPKNTLFVKARDEASSAEDQTASENIIPLSPQWLYAKPSETKTGLSGAPGD 3 MA D P + + +K+ DE +DQ A EN IPLSPQWL+AKPSE+K +S PGD Sbjct: 1 MAEGKFDLPDDLILMKSPDEYF--KDQLAFENSIPLSPQWLHAKPSESKASVSATPGD 56