BLASTX nr result
ID: Sinomenium21_contig00023449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00023449 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322376.2| hypothetical protein POPTR_0015s15360g [Popu... 65 1e-08 ref|XP_006362578.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004293756.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_002528370.1| pentatricopeptide repeat-containing protein,... 59 7e-07 ref|XP_007024941.1| Pentatricopeptide repeat superfamily protein... 58 2e-06 ref|XP_007024939.1| Pentatricopeptide repeat (PPR-like) superfam... 58 2e-06 ref|XP_004157755.1| PREDICTED: uncharacterized protein LOC101223... 58 2e-06 ref|XP_004145475.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_004233900.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_003631192.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 emb|CAN61637.1| hypothetical protein VITISV_008458 [Vitis vinifera] 57 2e-06 ref|XP_003533559.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_002322376.2| hypothetical protein POPTR_0015s15360g [Populus trichocarpa] gi|550322786|gb|EEF06503.2| hypothetical protein POPTR_0015s15360g [Populus trichocarpa] Length = 594 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD++QNVD++TLT F TACY+ N Y++ S+LS+RISK Sbjct: 550 FFHKLLDKDQNVDRVTLTAFTTACYESNKYALVSDLSERISK 591 >ref|XP_006362578.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X1 [Solanum tuberosum] gi|565393841|ref|XP_006362579.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X2 [Solanum tuberosum] gi|565393843|ref|XP_006362580.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X3 [Solanum tuberosum] Length = 716 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD++Q+VD++TL FM+ACY+ NNY + S +++RI+K Sbjct: 667 FFHKLLDKQQSVDRVTLAAFMSACYESNNYDLVSSMNERITK 708 >ref|XP_004293756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Fragaria vesca subsp. vesca] Length = 705 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK +D++QNVD++TL F TACY+ N Y++ S+L++RISK Sbjct: 661 FFHKLVDKDQNVDRVTLQAFTTACYESNKYALLSDLTERISK 702 >ref|XP_002528370.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532238|gb|EEF34042.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 712 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD++ NVD+ITL F TACY+ N +++ S+LS+RISK Sbjct: 668 FFHKLLDKDLNVDRITLAAFTTACYESNKFALVSDLSERISK 709 >ref|XP_007024941.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508780307|gb|EOY27563.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 738 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/42 (52%), Positives = 36/42 (85%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFH+ LD+++NVD++TL FMTACY+ + +++ S+L++RISK Sbjct: 694 FFHRLLDKDRNVDRVTLAAFMTACYETDKFALVSDLNERISK 735 >ref|XP_007024939.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508780305|gb|EOY27561.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 692 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/42 (52%), Positives = 36/42 (85%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFH+ LD+++NVD++TL FMTACY+ + +++ S+L++RISK Sbjct: 648 FFHRLLDKDRNVDRVTLAAFMTACYETDKFALVSDLNERISK 689 >ref|XP_004157755.1| PREDICTED: uncharacterized protein LOC101223774 [Cucumis sativus] Length = 1315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD+E NVD++TL F TAC + N Y++ S+LS+RISK Sbjct: 1271 FFHKLLDKEVNVDRVTLAAFNTACIESNKYALVSDLSERISK 1312 >ref|XP_004145475.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Cucumis sativus] Length = 728 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD+E NVD++TL F TAC + N Y++ S+LS+RISK Sbjct: 684 FFHKLLDKEVNVDRVTLAAFNTACIESNKYALVSDLSERISK 725 >ref|XP_004233900.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Solanum lycopersicum] Length = 716 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/42 (52%), Positives = 34/42 (80%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD++Q+VD++TL FM+ACY+ N Y + S +++RI+K Sbjct: 667 FFHKLLDKQQSVDRVTLAAFMSACYESNKYDLVSSMNERITK 708 >ref|XP_003631192.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Vitis vinifera] Length = 708 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRI 120 FFHK LD+E NV+++TL GFM CY+ N Y + SELS+RI Sbjct: 664 FFHKLLDKEPNVNRVTLLGFMNKCYESNKYGLVSELSERI 703 >emb|CAN61637.1| hypothetical protein VITISV_008458 [Vitis vinifera] Length = 708 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRI 120 FFHK LD+E NV+++TL GFM CY+ N Y + SELS+RI Sbjct: 664 FFHKLLDKEPNVNRVTLLGFMNKCYESNKYGLVSELSERI 703 >ref|XP_003533559.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X1 [Glycine max] gi|571479155|ref|XP_006587776.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X2 [Glycine max] gi|571479157|ref|XP_006587777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X3 [Glycine max] Length = 693 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 1 FFHKFLDEEQNVDQITLTGFMTACYDRNNYSVASELSKRISK 126 FFHK LD++ NV+++T+ FMTACY+ N Y + S+LS RI K Sbjct: 642 FFHKLLDKDPNVNRVTIAAFMTACYESNKYDLVSDLSARIYK 683