BLASTX nr result
ID: Sinomenium21_contig00023161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00023161 (627 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU18410.1| unknown [Glycine max] 54 7e-06 >gb|ACU18410.1| unknown [Glycine max] Length = 95 Score = 53.9 bits (128), Expect(2) = 7e-06 Identities = 36/74 (48%), Positives = 40/74 (54%) Frame = +2 Query: 338 TVSFDLPVLPLLPTSFFSWPLLFVFVIVPTLDIVPPPSAAALKPLFFVPLPLSFGSPQAF 517 T F L VL P SFF+W L VF +P L IV PP AALK F L S G PQA Sbjct: 21 TTLFGLDVLAPPPVSFFAWLLPSVFASLPALYIVLPPFFAALKLPFSELLQPSSGPPQAS 80 Query: 518 YPALLSPFELVPLS 559 + LLS + L P S Sbjct: 81 FQDLLSLYGLAPPS 94 Score = 22.3 bits (46), Expect(2) = 7e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 295 PKANDSFGR 321 PKAND+FGR Sbjct: 6 PKANDNFGR 14