BLASTX nr result
ID: Sinomenium21_contig00022946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00022946 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citr... 65 1e-08 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 65 1e-08 gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Mimulus... 64 2e-08 ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containin... 64 3e-08 ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 64 3e-08 emb|CBI32329.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containin... 63 4e-08 ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citr... 63 4e-08 gb|EPS58860.1| hypothetical protein M569_15950 [Genlisea aurea] 63 4e-08 ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containin... 63 5e-08 ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containin... 63 5e-08 ref|XP_006358428.1| PREDICTED: BTB/POZ and MATH domain-containin... 62 8e-08 ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus ... 62 8e-08 ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutr... 60 3e-07 ref|XP_004164626.1| PREDICTED: BTB/POZ and MATH domain-containin... 60 3e-07 ref|XP_004153182.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and ... 60 3e-07 ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 60 4e-07 ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prun... 60 4e-07 ref|XP_006297810.1| hypothetical protein CARUB_v10013845mg [Caps... 59 7e-07 ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containin... 59 7e-07 >ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|568852211|ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|557546400|gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] Length = 407 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSHQFKITGY+LSKG+GIGKYI SDTFMVGG Sbjct: 34 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGG 65 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSHQFKITGY+LSKG+GIGKYI SDTFMVGG Sbjct: 33 NGSHQFKITGYSLSKGLGIGKYIASDTFMVGG 64 >gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Mimulus guttatus] Length = 410 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/67 (55%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 193 MGMGRVCRV---PSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDS 23 +GMGRV + PS VNGSH FKITGY+LSKGIGIGKYI S Sbjct: 2 VGMGRVYQETAKPSSSSAAPSTPAVTTSISISETVNGSHDFKITGYSLSKGIGIGKYIAS 61 Query: 22 DTFMVGG 2 DTFMVGG Sbjct: 62 DTFMVGG 68 >ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 499 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH FKITGY+LSKGIGIGKYI SDTFMVGG Sbjct: 39 NGSHDFKITGYSLSKGIGIGKYIASDTFMVGG 70 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/62 (56%), Positives = 39/62 (62%) Frame = -1 Query: 187 MGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTFMV 8 MG+VCR K VNGSHQFKITGY+LSKG+GIGKYI SDTF+V Sbjct: 1 MGKVCREGGK--PSSSSPLVTTSTSITETVNGSHQFKITGYSLSKGLGIGKYIASDTFVV 58 Query: 7 GG 2 GG Sbjct: 59 GG 60 >emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/62 (56%), Positives = 39/62 (62%) Frame = -1 Query: 187 MGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTFMV 8 MG+VCR K VNGSHQFKITGY+LSKG+GIGKYI SDTF+V Sbjct: 1 MGKVCREGGK--PSSSSPLVTTSTSITETVNGSHQFKITGYSLSKGLGIGKYIASDTFVV 58 Query: 7 GG 2 GG Sbjct: 59 GG 60 >ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] Length = 403 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/64 (53%), Positives = 41/64 (64%) Frame = -1 Query: 193 MGMGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTF 14 MG RVC+ P+K +NGSHQFKI+GY+LSKG+GIGKYI SDTF Sbjct: 1 MGTIRVCKDPTK----PSITPVTTSTARNETINGSHQFKISGYSLSKGMGIGKYIASDTF 56 Query: 13 MVGG 2 +VGG Sbjct: 57 IVGG 60 >ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] gi|557521655|gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] Length = 403 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/64 (53%), Positives = 41/64 (64%) Frame = -1 Query: 193 MGMGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTF 14 MG RVC+ P+K +NGSHQFKI+GY+LSKG+GIGKYI SDTF Sbjct: 1 MGTIRVCKDPTK----PSITPVTTSTARNETINGSHQFKISGYSLSKGMGIGKYIASDTF 56 Query: 13 MVGG 2 +VGG Sbjct: 57 IVGG 60 >gb|EPS58860.1| hypothetical protein M569_15950 [Genlisea aurea] Length = 404 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH FKITGY+LSKGIGIGKY+ SDTFMVGG Sbjct: 31 NGSHDFKITGYSLSKGIGIGKYVASDTFMVGG 62 >ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 2 [Vitis vinifera] Length = 443 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -1 Query: 193 MGMGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTF 14 MG R CR SK VNGSH+FKI GY+L+KG+GIG+YI SDTF Sbjct: 1 MGTVRACRETSKPSTSSPPPVTTTSTSRSETVNGSHEFKIDGYSLAKGMGIGRYIASDTF 60 Query: 13 MVGG 2 MVGG Sbjct: 61 MVGG 64 >ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297736968|emb|CBI26169.3| unnamed protein product [Vitis vinifera] Length = 408 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = -1 Query: 193 MGMGRVCRVPSKHXXXXXXXXXXXXXXXXXXVNGSHQFKITGYNLSKGIGIGKYIDSDTF 14 MG R CR SK VNGSH+FKI GY+L+KG+GIG+YI SDTF Sbjct: 1 MGTVRACRETSKPSTSSPPPVTTTSTSRSETVNGSHEFKIDGYSLAKGMGIGRYIASDTF 60 Query: 13 MVGG 2 MVGG Sbjct: 61 MVGG 64 >ref|XP_006358428.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum tuberosum] Length = 411 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH FKI GY+LSKGIGIGKYI SDTFMVGG Sbjct: 38 NGSHDFKINGYSLSKGIGIGKYITSDTFMVGG 69 >ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223535995|gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSHQFKITGY+LSKG+GIGKYI SDTF VGG Sbjct: 40 NGSHQFKITGYSLSKGLGIGKYIASDTFNVGG 71 >ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum] gi|557109117|gb|ESQ49424.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum] Length = 406 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH+FKI+GY+L+KG+GIGKY+ SDTFMVGG Sbjct: 32 NGSHEFKISGYSLAKGMGIGKYVASDTFMVGG 63 >ref|XP_004164626.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like, partial [Cucumis sativus] Length = 258 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH+FKI GY+L+KG+GIGKYI SDTFMVGG Sbjct: 36 NGSHEFKINGYSLNKGMGIGKYIASDTFMVGG 67 >ref|XP_004153182.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing protein 2-like [Cucumis sativus] Length = 416 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH+FKI GY+L+KG+GIGKYI SDTFMVGG Sbjct: 36 NGSHEFKINGYSLNKGMGIGKYIASDTFMVGG 67 >ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508713600|gb|EOY05497.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 410 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSHQFKI+GY+L+KG+G+GKYI S+TFMVGG Sbjct: 36 NGSHQFKISGYSLAKGMGVGKYIASETFMVGG 67 >ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica] gi|462396451|gb|EMJ02250.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica] Length = 409 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NG+H FKITGY+LSKGIGIGKYI SDTF VGG Sbjct: 36 NGTHHFKITGYSLSKGIGIGKYIASDTFNVGG 67 >ref|XP_006297810.1| hypothetical protein CARUB_v10013845mg [Capsella rubella] gi|482566519|gb|EOA30708.1| hypothetical protein CARUB_v10013845mg [Capsella rubella] Length = 407 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NGSH+FKI+GY+L KG+GIGKY+ SDTFMVGG Sbjct: 33 NGSHEFKISGYSLVKGMGIGKYVASDTFMVGG 64 >ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 411 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 97 NGSHQFKITGYNLSKGIGIGKYIDSDTFMVGG 2 NG+HQFKITGY+LSKG+GIGKY+ SD F VGG Sbjct: 38 NGTHQFKITGYSLSKGMGIGKYVSSDVFNVGG 69