BLASTX nr result
ID: Sinomenium21_contig00022914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00022914 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38001.1| hypothetical protein L484_004791 [Morus notabilis] 79 9e-13 ref|XP_002274155.1| PREDICTED: uncharacterized protein LOC100255... 76 4e-12 ref|XP_006447297.1| hypothetical protein CICLE_v10017871mg [Citr... 75 7e-12 ref|XP_004146250.1| PREDICTED: uncharacterized protein LOC101222... 75 7e-12 gb|ABC41688.1| unknown [Musa acuminata] 74 2e-11 ref|XP_003634678.1| PREDICTED: uncharacterized protein LOC100260... 74 2e-11 ref|XP_002517907.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 ref|XP_004294017.1| PREDICTED: uncharacterized protein LOC101293... 73 4e-11 ref|XP_002305133.1| hypothetical protein POPTR_0004s04390g [Popu... 73 4e-11 ref|XP_002263054.1| PREDICTED: uncharacterized protein LOC100256... 73 4e-11 gb|AFG45331.1| hypothetical protein 2_8958_01, partial [Pinus ta... 73 5e-11 gb|AEW08406.1| hypothetical protein 2_8958_01, partial [Pinus ra... 73 5e-11 ref|XP_002531718.1| conserved hypothetical protein [Ricinus comm... 73 5e-11 gb|EYU26383.1| hypothetical protein MIMGU_mgv1a015829mg [Mimulus... 72 1e-10 ref|XP_006376479.1| hypothetical protein POPTR_0013s13370g [Popu... 72 1e-10 ref|XP_002509471.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 gb|ABK23005.1| unknown [Picea sitchensis] 72 1e-10 gb|ABK21749.1| unknown [Picea sitchensis] 72 1e-10 gb|EXC35136.1| hypothetical protein L484_021498 [Morus notabilis] 71 1e-10 ref|XP_006357477.1| PREDICTED: uncharacterized protein LOC102593... 71 1e-10 >gb|EXB38001.1| hypothetical protein L484_004791 [Morus notabilis] Length = 120 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERRLE LA+DWP+QV+GD+VL LSWVFFLVYSWREKYD Sbjct: 82 FERRLEVLAWDWPKQVIGDLVLALSWVFFLVYSWREKYD 120 >ref|XP_002274155.1| PREDICTED: uncharacterized protein LOC100255813 [Vitis vinifera] gi|302143297|emb|CBI21858.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERRLE LA+DWPRQV GD+ L LSWVFFLVYSWREKYD Sbjct: 106 FERRLEDLAWDWPRQVAGDLALALSWVFFLVYSWREKYD 144 >ref|XP_006447297.1| hypothetical protein CICLE_v10017871mg [Citrus clementina] gi|568884556|ref|XP_006494945.1| PREDICTED: uncharacterized protein LOC102626090 [Citrus sinensis] gi|557549908|gb|ESR60537.1| hypothetical protein CICLE_v10017871mg [Citrus clementina] Length = 144 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERRL LA+DWPRQVVGD+ L LSWVFFLVYSWREKYD Sbjct: 106 FERRLADLAWDWPRQVVGDLALALSWVFFLVYSWREKYD 144 >ref|XP_004146250.1| PREDICTED: uncharacterized protein LOC101222658 [Cucumis sativus] gi|449525359|ref|XP_004169685.1| PREDICTED: uncharacterized LOC101222658 [Cucumis sativus] Length = 144 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER+LE LA DWPRQVVGD+ L LSWVFFLVYSWREKYD Sbjct: 106 FERKLEDLARDWPRQVVGDVTLALSWVFFLVYSWREKYD 144 >gb|ABC41688.1| unknown [Musa acuminata] Length = 92 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERRLE LA DWPRQ+VGD+VL LSWV FLVYSWREKYD Sbjct: 54 FERRLEDLARDWPRQLVGDLVLSLSWVLFLVYSWREKYD 92 >ref|XP_003634678.1| PREDICTED: uncharacterized protein LOC100260596 [Vitis vinifera] Length = 144 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER+LE LA+DWP+QVVGDIVL LSWVF +VYSWREKYD Sbjct: 106 FERKLEDLAWDWPKQVVGDIVLALSWVFLVVYSWREKYD 144 >ref|XP_002517907.1| conserved hypothetical protein [Ricinus communis] gi|223542889|gb|EEF44425.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERRLE LA+ WP+Q++GD++L LSWVFFLVYSWREKYD Sbjct: 32 FERRLEDLAWHWPKQMIGDLILALSWVFFLVYSWREKYD 70 >ref|XP_004294017.1| PREDICTED: uncharacterized protein LOC101293666 [Fragaria vesca subsp. vesca] Length = 151 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERR+E LA+DW RQ VGD+VL LSWVFFLVYSWREKYD Sbjct: 113 FERRVEDLAWDWLRQTVGDVVLALSWVFFLVYSWREKYD 151 >ref|XP_002305133.1| hypothetical protein POPTR_0004s04390g [Populus trichocarpa] gi|118484061|gb|ABK93916.1| unknown [Populus trichocarpa] gi|222848097|gb|EEE85644.1| hypothetical protein POPTR_0004s04390g [Populus trichocarpa] Length = 143 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERR+E LA+DW RQ VGDI+LGLSWV FLVYSWREKYD Sbjct: 105 FERRVEVLAWDWLRQTVGDILLGLSWVLFLVYSWREKYD 143 >ref|XP_002263054.1| PREDICTED: uncharacterized protein LOC100256771 [Vitis vinifera] gi|297735997|emb|CBI23971.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERR+E LA DW RQ+VGDI+L LSWVFFLVYSWREKYD Sbjct: 112 FERRVEDLALDWLRQIVGDILLALSWVFFLVYSWREKYD 150 >gb|AFG45331.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129279|gb|AFG45332.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129281|gb|AFG45333.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129283|gb|AFG45334.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129285|gb|AFG45335.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129287|gb|AFG45336.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129289|gb|AFG45337.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129291|gb|AFG45338.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129293|gb|AFG45339.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129295|gb|AFG45340.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129297|gb|AFG45341.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129299|gb|AFG45342.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129301|gb|AFG45343.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129303|gb|AFG45344.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129305|gb|AFG45345.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129307|gb|AFG45346.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129309|gb|AFG45347.1| hypothetical protein 2_8958_01, partial [Pinus taeda] Length = 103 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 F RR+E LA DWPRQVVGDI++ LSWVFFLVY+WREKYD Sbjct: 65 FARRVEDLARDWPRQVVGDIIMSLSWVFFLVYNWREKYD 103 >gb|AEW08406.1| hypothetical protein 2_8958_01, partial [Pinus radiata] Length = 103 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 F RR+E LA DWPRQVVGDI++ LSWVFFLVY+WREKYD Sbjct: 65 FARRVEDLARDWPRQVVGDIIMSLSWVFFLVYNWREKYD 103 >ref|XP_002531718.1| conserved hypothetical protein [Ricinus communis] gi|223528661|gb|EEF30677.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER+LE LA D PR VVGDIVLGLSWVFFLVYSWREKYD Sbjct: 32 FERKLEDLAHDLPRLVVGDIVLGLSWVFFLVYSWREKYD 70 >gb|EYU26383.1| hypothetical protein MIMGU_mgv1a015829mg [Mimulus guttatus] Length = 144 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER++E L DW R V+GDIVLGLSWVFFLVYSWREKYD Sbjct: 106 FERKIEVLGHDWVRLVLGDIVLGLSWVFFLVYSWREKYD 144 >ref|XP_006376479.1| hypothetical protein POPTR_0013s13370g [Populus trichocarpa] gi|550325755|gb|ERP54276.1| hypothetical protein POPTR_0013s13370g [Populus trichocarpa] Length = 144 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERR+E LA+DWP+QV GD V+ LSWVFFL+Y+WREKYD Sbjct: 106 FERRVEDLAWDWPKQVAGDFVMALSWVFFLLYTWREKYD 144 >ref|XP_002509471.1| conserved hypothetical protein [Ricinus communis] gi|223549370|gb|EEF50858.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FERR++ LA+DW RQ+VGD +L LSWVFFLVYSWREKYD Sbjct: 107 FERRVDVLAWDWLRQIVGDFLLALSWVFFLVYSWREKYD 145 >gb|ABK23005.1| unknown [Picea sitchensis] Length = 143 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 F RR+E LA DWPRQ+VGDI++ LSWVFFLVY+WREKYD Sbjct: 105 FARRVEDLARDWPRQLVGDIIMSLSWVFFLVYNWREKYD 143 >gb|ABK21749.1| unknown [Picea sitchensis] Length = 143 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 F RR+E LA DWPRQ+VGDI++ LSWVFFLVY+WREKYD Sbjct: 105 FARRVEDLARDWPRQLVGDIIMSLSWVFFLVYNWREKYD 143 >gb|EXC35136.1| hypothetical protein L484_021498 [Morus notabilis] Length = 144 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER+LE L+ DWPRQVVGDI L SWVF LVYSWREKYD Sbjct: 106 FERKLEDLSSDWPRQVVGDIALAFSWVFLLVYSWREKYD 144 >ref|XP_006357477.1| PREDICTED: uncharacterized protein LOC102593512 [Solanum tuberosum] Length = 144 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 337 FERRLEALAFDWPRQVVGDIVLGLSWVFFLVYSWREKYD 221 FER++E LA+DWPRQ+VGD VL LSWVFFLV SWR+KYD Sbjct: 106 FERKVEDLAYDWPRQLVGDFVLALSWVFFLVSSWRDKYD 144