BLASTX nr result
ID: Sinomenium21_contig00022867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00022867 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23992.1| unknown [Picea sitchensis] 84 2e-14 ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Popu... 83 5e-14 ref|XP_004507778.1| PREDICTED: HD domain-containing protein 2-li... 83 5e-14 ref|XP_003518233.2| PREDICTED: HD domain-containing protein 2-li... 82 6e-14 ref|XP_007154842.1| hypothetical protein PHAVU_003G152400g [Phas... 82 6e-14 ref|XP_003549521.2| PREDICTED: HD domain-containing protein 2-li... 82 8e-14 ref|XP_004162687.1| PREDICTED: HD domain-containing protein 2-li... 82 8e-14 ref|XP_004144789.1| PREDICTED: HD domain-containing protein 2-li... 82 8e-14 gb|EYU37124.1| hypothetical protein MIMGU_mgv1a012883mg [Mimulus... 82 1e-13 gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] 82 1e-13 gb|EXB94889.1| HD domain-containing protein 2 [Morus notabilis] 81 1e-13 ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [A... 81 1e-13 ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Caps... 81 1e-13 ref|XP_003570627.1| PREDICTED: HD domain-containing protein 2-li... 81 1e-13 ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-c... 81 2e-13 ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-li... 80 2e-13 ref|XP_006404869.1| hypothetical protein EUTSA_v10000291mg [Eutr... 80 2e-13 ref|XP_004951699.1| PREDICTED: HD domain-containing protein 2-li... 80 2e-13 ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-li... 80 2e-13 ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis t... 80 2e-13 >gb|ABK23992.1| unknown [Picea sitchensis] Length = 197 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRR 133 VEMILQALEYE QGKNLDEFFQSTAGKFQTD+GKAWA EIVSRR Sbjct: 150 VEMILQALEYETAQGKNLDEFFQSTAGKFQTDLGKAWAAEIVSRR 194 >ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] gi|550336643|gb|EEE92898.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] Length = 248 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+L+EFFQSTAGKFQT+VGKAWA EI SRRR Sbjct: 200 VEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWALEIASRRR 245 >ref|XP_004507778.1| PREDICTED: HD domain-containing protein 2-like isoform X2 [Cicer arietinum] Length = 242 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRR 133 VEMILQALEYE EQGK+LDEFFQSTAGKFQT++GKAWA EIVSRR Sbjct: 195 VEMILQALEYEDEQGKDLDEFFQSTAGKFQTEIGKAWASEIVSRR 239 >ref|XP_003518233.2| PREDICTED: HD domain-containing protein 2-like [Glycine max] Length = 234 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+LDEFFQSTAGKFQT+ GKAWA EIVSRR+ Sbjct: 186 VEMILQALEYEDEQGKDLDEFFQSTAGKFQTETGKAWASEIVSRRK 231 >ref|XP_007154842.1| hypothetical protein PHAVU_003G152400g [Phaseolus vulgaris] gi|561028196|gb|ESW26836.1| hypothetical protein PHAVU_003G152400g [Phaseolus vulgaris] Length = 226 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+LDEFFQSTAGKFQT+ GKAWA EIVSRR+ Sbjct: 179 VEMILQALEYEDEQGKDLDEFFQSTAGKFQTETGKAWASEIVSRRK 224 >ref|XP_003549521.2| PREDICTED: HD domain-containing protein 2-like [Glycine max] Length = 234 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE+EQGK+LDEFF STAGKFQT+ GKAWA EIVSRR+ Sbjct: 186 VEMILQALEYEVEQGKDLDEFFWSTAGKFQTETGKAWASEIVSRRK 231 >ref|XP_004162687.1| PREDICTED: HD domain-containing protein 2-like [Cucumis sativus] Length = 226 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRRAI 124 VEMILQALEYE EQGK+LDEFFQSTAGKFQT++G+AWA EIVSRR ++ Sbjct: 168 VEMILQALEYENEQGKDLDEFFQSTAGKFQTELGRAWASEIVSRRSSV 215 >ref|XP_004144789.1| PREDICTED: HD domain-containing protein 2-like [Cucumis sativus] Length = 230 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRRAI 124 VEMILQALEYE EQGK+LDEFFQSTAGKFQT++G+AWA EIVSRR ++ Sbjct: 172 VEMILQALEYENEQGKDLDEFFQSTAGKFQTELGRAWASEIVSRRSSV 219 >gb|EYU37124.1| hypothetical protein MIMGU_mgv1a012883mg [Mimulus guttatus] gi|604332465|gb|EYU37125.1| hypothetical protein MIMGU_mgv1a012883mg [Mimulus guttatus] Length = 237 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+L+EFF+STAGKFQTD+GKAWA E+ SRRR Sbjct: 190 VEMILQALEYEKEQGKDLEEFFESTAGKFQTDLGKAWALEVASRRR 235 >gb|AHB08880.1| HD domain-containing protein [Suaeda glauca] Length = 208 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+L+EFF+STAGKFQTD+GKAWA EI SRR+ Sbjct: 161 VEMILQALEYEKEQGKDLEEFFESTAGKFQTDIGKAWALEIASRRK 206 >gb|EXB94889.1| HD domain-containing protein 2 [Morus notabilis] Length = 262 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+LDEFFQSTAGKFQT++GKAWA EI SRR+ Sbjct: 214 VEMILQALEYESEQGKDLDEFFQSTAGKFQTELGKAWASEIASRRQ 259 >ref|XP_006845465.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] gi|548848037|gb|ERN07140.1| hypothetical protein AMTR_s00019p00129010 [Amborella trichopoda] Length = 212 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRRAI 124 VEMILQALEYE EQGK+L+EFF+STAGKFQTDVGKAWA EI SRR+ + Sbjct: 161 VEMILQALEYENEQGKDLNEFFESTAGKFQTDVGKAWAAEIASRRKRL 208 >ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] gi|482563570|gb|EOA27760.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] Length = 250 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VE+ILQALEYE QGK+L+EFFQSTAGKFQTD+GKAWA EIVSRRR Sbjct: 202 VELILQALEYEQAQGKDLEEFFQSTAGKFQTDIGKAWAAEIVSRRR 247 >ref|XP_003570627.1| PREDICTED: HD domain-containing protein 2-like [Brachypodium distachyon] Length = 243 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQG++L+EFFQSTAGKFQTDVGKAWA EI SRR+ Sbjct: 198 VEMILQALEYEKEQGRDLEEFFQSTAGKFQTDVGKAWAAEIASRRK 243 >ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324539|gb|EFH54959.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 257 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VE+ILQALEYE QGK+L+EFFQSTAGKFQTD+GKAWA EIVSRRR Sbjct: 209 VELILQALEYEQGQGKDLEEFFQSTAGKFQTDIGKAWASEIVSRRR 254 >ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-like [Solanum tuberosum] Length = 241 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+L+EFFQSTAGKFQT+VGKAWA E+ SRR+ Sbjct: 193 VEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVASRRK 238 >ref|XP_006404869.1| hypothetical protein EUTSA_v10000291mg [Eutrema salsugineum] gi|557105997|gb|ESQ46322.1| hypothetical protein EUTSA_v10000291mg [Eutrema salsugineum] Length = 264 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 +EMILQALEYE +QGK+L+EFFQSTAGKFQTD+GKAWA EI SRR+ Sbjct: 216 LEMILQALEYEQDQGKDLEEFFQSTAGKFQTDIGKAWALEIASRRK 261 >ref|XP_004951699.1| PREDICTED: HD domain-containing protein 2-like [Setaria italica] Length = 250 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 +EMILQALEYE EQG++L+EFFQSTAGKFQTD+GKAWA EI SRR+ Sbjct: 203 IEMILQALEYEKEQGRDLEEFFQSTAGKFQTDIGKAWAAEIASRRK 248 >ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-like [Solanum lycopersicum] Length = 242 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VEMILQALEYE EQGK+L+EFFQSTAGKFQT+VGKAWA E+ SRR+ Sbjct: 194 VEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVASRRK 239 >ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] gi|50253436|gb|AAT71920.1| At2g23820 [Arabidopsis thaliana] gi|58331781|gb|AAW70388.1| At2g23820 [Arabidopsis thaliana] gi|330252401|gb|AEC07495.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] Length = 257 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 267 VEMILQALEYEIEQGKNLDEFFQSTAGKFQTDVGKAWAFEIVSRRR 130 VE+ILQALEYE +QGK+L+EFFQSTAGKFQT++GKAWA EIVSRRR Sbjct: 209 VELILQALEYEQDQGKDLEEFFQSTAGKFQTNIGKAWASEIVSRRR 254