BLASTX nr result
ID: Sinomenium21_contig00022788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00022788 (645 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534948.1| conserved hypothetical protein [Ricinus comm... 77 3e-12 emb|CBI36501.3| unnamed protein product [Vitis vinifera] 75 1e-11 >ref|XP_002534948.1| conserved hypothetical protein [Ricinus communis] gi|223524314|gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -2 Query: 335 SQLLAFSLPRGEGSLTYGFQAWREAKGLDLTYDQISGQP 219 S LLAFSLPRGEGSLTYGFQAWR+AKGLD TYDQISGQP Sbjct: 76 SLLLAFSLPRGEGSLTYGFQAWRKAKGLDFTYDQISGQP 114 >emb|CBI36501.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 329 LLAFSLPRGEGSLTYGFQAWREAKGLDLTYDQISGQP 219 LLAFSLP+GEGSLTYGFQAWRE KGLD TYDQISGQP Sbjct: 238 LLAFSLPKGEGSLTYGFQAWREVKGLDFTYDQISGQP 274