BLASTX nr result
ID: Sinomenium21_contig00022736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00022736 (856 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273726.1| PREDICTED: chromo domain protein LHP1 [Vitis... 66 2e-08 gb|EXB70624.1| Chromo domain-containing protein LHP1 [Morus nota... 64 6e-08 ref|XP_004307292.1| PREDICTED: chromo domain-containing protein ... 64 1e-07 ref|XP_007029870.1| Chromodomain protein, putative isoform 1 [Th... 61 6e-07 ref|XP_004145010.1| PREDICTED: chromo domain-containing protein ... 60 1e-06 dbj|BAA25905.1| polycomb-like protein [Daucus carota] 60 1e-06 dbj|BAF75817.1| terminal flower 2 protein [Malus domestica] 60 1e-06 dbj|BAF75818.1| terminal flower 2 protein [Malus domestica] 60 1e-06 dbj|BAF75819.1| terminal flower 2 protein [Malus domestica] 60 1e-06 dbj|BAF75816.1| terminal flower 2 protein [Malus domestica] gi|1... 60 1e-06 gb|EYU42242.1| hypothetical protein MIMGU_mgv1a006455mg [Mimulus... 59 2e-06 gb|EYU37386.1| hypothetical protein MIMGU_mgv1a007236mg [Mimulus... 59 2e-06 ref|XP_006661688.1| PREDICTED: probable chromo domain-containing... 59 2e-06 ref|XP_006484756.1| PREDICTED: chromo domain-containing protein ... 59 2e-06 ref|XP_006437337.1| hypothetical protein CICLE_v10031549mg [Citr... 59 2e-06 ref|XP_003604079.1| Chromo domain-containing protein LHP1 [Medic... 59 2e-06 emb|CAX46397.1| putative LHP1 protein [Rosa lucieae] 59 2e-06 ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus c... 59 2e-06 ref|XP_004501104.1| PREDICTED: chromo domain protein LHP1-like [... 59 3e-06 ref|XP_003573876.1| PREDICTED: probable chromo domain-containing... 57 7e-06 >ref|XP_002273726.1| PREDICTED: chromo domain protein LHP1 [Vitis vinifera] gi|296090196|emb|CBI40015.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTPPT 108 RSDG+EV+VD+KFLK NNPLLLI+FYEQHLRY+P T Sbjct: 389 RSDGKEVMVDNKFLKANNPLLLINFYEQHLRYSPTT 424 >gb|EXB70624.1| Chromo domain-containing protein LHP1 [Morus notabilis] Length = 451 Score = 64.3 bits (155), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 R+DGREV+VD+KFLK NNPLLLIS+YEQHLRY+P Sbjct: 416 RADGREVMVDNKFLKANNPLLLISYYEQHLRYSP 449 >ref|XP_004307292.1| PREDICTED: chromo domain-containing protein LHP1-like [Fragaria vesca subsp. vesca] Length = 458 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+KFLKVN+PLLLI+FYEQHLRY+P Sbjct: 423 RSDGTEVIVDNKFLKVNHPLLLINFYEQHLRYSP 456 >ref|XP_007029870.1| Chromodomain protein, putative isoform 1 [Theobroma cacao] gi|508718475|gb|EOY10372.1| Chromodomain protein, putative isoform 1 [Theobroma cacao] Length = 430 Score = 60.8 bits (146), Expect = 6e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG+EV+VD+++LK NNPLLLI+FYEQHL+Y+P Sbjct: 395 RSDGKEVMVDNRYLKANNPLLLINFYEQHLKYSP 428 >ref|XP_004145010.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] gi|449473948|ref|XP_004154028.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] gi|449498945|ref|XP_004160678.1| PREDICTED: chromo domain-containing protein LHP1-like [Cucumis sativus] Length = 454 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYT 99 RSDG EVVVD+KFLK NPLLLI+FYEQHLRYT Sbjct: 419 RSDGTEVVVDNKFLKAINPLLLINFYEQHLRYT 451 >dbj|BAA25905.1| polycomb-like protein [Daucus carota] Length = 392 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/32 (75%), Positives = 32/32 (100%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRY 96 RSDG+E++VD+KFLKVNNPL+LI+FYE+HL+Y Sbjct: 322 RSDGKEIIVDNKFLKVNNPLMLINFYEKHLKY 353 >dbj|BAF75817.1| terminal flower 2 protein [Malus domestica] Length = 453 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K LKVN+PLLLI FYEQHLRY P Sbjct: 418 RSDGSEVIVDNKSLKVNHPLLLIDFYEQHLRYNP 451 >dbj|BAF75818.1| terminal flower 2 protein [Malus domestica] Length = 456 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K LKVN+PLLLI FYEQHLRY P Sbjct: 421 RSDGSEVIVDNKSLKVNHPLLLIDFYEQHLRYNP 454 >dbj|BAF75819.1| terminal flower 2 protein [Malus domestica] Length = 456 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K LKVN+PLLLI FYEQHLRY P Sbjct: 421 RSDGSEVIVDNKSLKVNHPLLLIDFYEQHLRYNP 454 >dbj|BAF75816.1| terminal flower 2 protein [Malus domestica] gi|156104762|dbj|BAF75820.1| like heterochromatin protein 1 [Malus domestica] Length = 453 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K LKVN+PLLLI FYEQHLRY P Sbjct: 418 RSDGSEVIVDNKSLKVNHPLLLIDFYEQHLRYNP 451 >gb|EYU42242.1| hypothetical protein MIMGU_mgv1a006455mg [Mimulus guttatus] Length = 443 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG +V VD+KFLK NNPLLLI FYE+HLRY+P Sbjct: 409 RSDGTKVTVDNKFLKANNPLLLIDFYEKHLRYSP 442 >gb|EYU37386.1| hypothetical protein MIMGU_mgv1a007236mg [Mimulus guttatus] Length = 414 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG +V VD+KFLK NNPLLLI FYE+HLRY+P Sbjct: 380 RSDGTKVTVDNKFLKANNPLLLIDFYEKHLRYSP 413 >ref|XP_006661688.1| PREDICTED: probable chromo domain-containing protein LHP1-like [Oryza brachyantha] Length = 417 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG+EV VD K LK NNPLLLIS+YEQHLRY P Sbjct: 382 RSDGQEVTVDDKELKANNPLLLISYYEQHLRYNP 415 >ref|XP_006484756.1| PREDICTED: chromo domain-containing protein LHP1-like [Citrus sinensis] Length = 440 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYT 99 RSDG+EV+VD+K+LK NNPLLLI+FYEQHL+Y+ Sbjct: 406 RSDGKEVMVDNKYLKANNPLLLINFYEQHLKYS 438 >ref|XP_006437337.1| hypothetical protein CICLE_v10031549mg [Citrus clementina] gi|557539533|gb|ESR50577.1| hypothetical protein CICLE_v10031549mg [Citrus clementina] Length = 441 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYT 99 RSDG+EV+VD+K+LK NNPLLLI+FYEQHL+Y+ Sbjct: 407 RSDGKEVMVDNKYLKANNPLLLINFYEQHLKYS 439 >ref|XP_003604079.1| Chromo domain-containing protein LHP1 [Medicago truncatula] gi|355493127|gb|AES74330.1| Chromo domain-containing protein LHP1 [Medicago truncatula] Length = 275 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K+LK NNP LLI+FYEQHLRY P Sbjct: 241 RSDGTEVMVDNKYLKANNPQLLINFYEQHLRYNP 274 >emb|CAX46397.1| putative LHP1 protein [Rosa lucieae] Length = 324 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRY 96 RSDG EV+VD+KF KVN+PLLLI+FYEQHLRY Sbjct: 293 RSDGTEVIVDNKFFKVNHPLLLINFYEQHLRY 324 >ref|XP_002523971.1| Heterochromatin protein, putative [Ricinus communis] gi|223536698|gb|EEF38339.1| Heterochromatin protein, putative [Ricinus communis] Length = 462 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYT 99 RSDG+EV+VD+ FLK NNPLLLI FYEQHL+Y+ Sbjct: 429 RSDGKEVIVDNSFLKANNPLLLIDFYEQHLKYS 461 >ref|XP_004501104.1| PREDICTED: chromo domain protein LHP1-like [Cicer arietinum] Length = 318 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG EV+VD+K+LK NPLLLI+FYEQHLRY P Sbjct: 283 RSDGTEVMVDNKYLKTYNPLLLINFYEQHLRYNP 316 >ref|XP_003573876.1| PREDICTED: probable chromo domain-containing protein LHP1-like [Brachypodium distachyon] Length = 416 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 1 RSDGREVVVDSKFLKVNNPLLLISFYEQHLRYTP 102 RSDG+EV+VD K LK NNPL+LI++YEQHLRY P Sbjct: 381 RSDGQEVLVDDKELKANNPLVLINYYEQHLRYNP 414