BLASTX nr result
ID: Sinomenium21_contig00021849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00021849 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475555.1| PREDICTED: golgin candidate 1-like [Citrus s... 58 2e-06 ref|XP_006451270.1| hypothetical protein CICLE_v10007632mg [Citr... 58 2e-06 >ref|XP_006475555.1| PREDICTED: golgin candidate 1-like [Citrus sinensis] Length = 701 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +3 Query: 3 VANELSEEQPDLKPPASNGSEFQGRRTKTK-KPQPGLASNESPKKSDIVKEQANIQASAA 179 V NEL++EQ D + PASNG Q ++ K++ K Q +++ES K +D +EQAN QAS Sbjct: 22 VVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPV 81 Query: 180 DNVAPNTDKMALSSE 224 D V PN D L+ E Sbjct: 82 D-VTPNKDTATLAVE 95 >ref|XP_006451270.1| hypothetical protein CICLE_v10007632mg [Citrus clementina] gi|557554496|gb|ESR64510.1| hypothetical protein CICLE_v10007632mg [Citrus clementina] Length = 701 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +3 Query: 3 VANELSEEQPDLKPPASNGSEFQGRRTKTK-KPQPGLASNESPKKSDIVKEQANIQASAA 179 V NEL++EQ D + PASNG Q ++ K++ K Q +++ES K +D +EQAN QAS Sbjct: 22 VVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPV 81 Query: 180 DNVAPNTDKMALSSE 224 D V PN D L+ E Sbjct: 82 D-VTPNKDTATLAVE 95