BLASTX nr result
ID: Sinomenium21_contig00021831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00021831 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300753.2| hypothetical protein POPTR_0002s03380g [Popu... 67 2e-09 ref|XP_006383714.1| hypothetical protein POPTR_0005s25240g [Popu... 67 2e-09 ref|XP_006383713.1| hypothetical protein POPTR_0005s25240g [Popu... 67 2e-09 ref|XP_007223238.1| hypothetical protein PRUPE_ppa005486mg [Prun... 67 2e-09 ref|XP_006473548.1| PREDICTED: transcription factor bHLH110-like... 66 4e-09 ref|XP_006435050.1| hypothetical protein CICLE_v10001291mg [Citr... 66 6e-09 gb|EXC25054.1| hypothetical protein L484_021925 [Morus notabilis] 64 2e-08 ref|XP_002281118.2| PREDICTED: transcription factor bHLH110-like... 64 2e-08 emb|CAN61992.1| hypothetical protein VITISV_030445 [Vitis vinifera] 64 2e-08 ref|XP_006341970.1| PREDICTED: transcription factor bHLH110-like... 64 3e-08 ref|XP_004238285.1| PREDICTED: transcription factor bHLH110-like... 64 3e-08 ref|XP_002307676.2| hypothetical protein POPTR_0005s25240g [Popu... 63 4e-08 ref|XP_006643643.1| PREDICTED: uncharacterized protein LOC102705... 63 5e-08 ref|XP_007017613.1| Basic helix-loop-helix DNA-binding superfami... 63 5e-08 ref|XP_004164011.1| PREDICTED: transcription factor bHLH110-like... 62 6e-08 ref|XP_004147875.1| PREDICTED: transcription factor bHLH110-like... 62 6e-08 ref|XP_002510430.1| transcription factor, putative [Ricinus comm... 62 6e-08 dbj|BAD44875.1| putative ethylene-responsive protein [Oryza sati... 62 1e-07 gb|EEC69777.1| hypothetical protein OsI_00047 [Oryza sativa Indi... 62 1e-07 ref|NP_001041771.1| Os01g0105700 [Oryza sativa Japonica Group] g... 62 1e-07 >ref|XP_002300753.2| hypothetical protein POPTR_0002s03380g [Populus trichocarpa] gi|550344194|gb|EEE80026.2| hypothetical protein POPTR_0002s03380g [Populus trichocarpa] Length = 423 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESLG---VWPPPNFGGRT 166 E KRDLRS GLCLVPLSCMSY+TS+ G +WPPPNFGG T Sbjct: 382 EPKRDLRSRGLCLVPLSCMSYVTSDGGGGGSIWPPPNFGGGT 423 >ref|XP_006383714.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] gi|550339707|gb|ERP61511.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] Length = 430 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSE--SLGVWPPPNFGGRT 166 E+KRDLRS GLCLVPLSCMSY+T++ G+WPPPNFGG T Sbjct: 390 ESKRDLRSRGLCLVPLSCMSYVTTDGGGGGIWPPPNFGGGT 430 >ref|XP_006383713.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] gi|550339706|gb|ERP61510.1| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] Length = 355 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSE--SLGVWPPPNFGGRT 166 E+KRDLRS GLCLVPLSCMSY+T++ G+WPPPNFGG T Sbjct: 315 ESKRDLRSRGLCLVPLSCMSYVTTDGGGGGIWPPPNFGGGT 355 >ref|XP_007223238.1| hypothetical protein PRUPE_ppa005486mg [Prunus persica] gi|462420174|gb|EMJ24437.1| hypothetical protein PRUPE_ppa005486mg [Prunus persica] Length = 458 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 3/48 (6%) Frame = +2 Query: 32 EIRDEGEAKRDLRSSGLCLVPLSCMSYITS---ESLGVWPPPNFGGRT 166 EI + E KRDLRS GLCLVPLSCMSY+TS E +WP PNFGG T Sbjct: 411 EINENDETKRDLRSRGLCLVPLSCMSYVTSDIGEGGSIWPAPNFGGGT 458 >ref|XP_006473548.1| PREDICTED: transcription factor bHLH110-like [Citrus sinensis] Length = 431 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESL--GVWPPPNFGGRT 166 E KRDLRS GLCLVPLSCMSY+T+++ G+WPPP+FGG T Sbjct: 391 EPKRDLRSRGLCLVPLSCMSYVTNDACGGGIWPPPSFGGGT 431 >ref|XP_006435050.1| hypothetical protein CICLE_v10001291mg [Citrus clementina] gi|557537172|gb|ESR48290.1| hypothetical protein CICLE_v10001291mg [Citrus clementina] Length = 419 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESL--GVWPPPNFGGRT 166 E KRDLRS GLCLVPLSCMSY+T++ G+WPPP+FGG T Sbjct: 379 EPKRDLRSRGLCLVPLSCMSYVTNDDCGGGIWPPPSFGGGT 419 >gb|EXC25054.1| hypothetical protein L484_021925 [Morus notabilis] Length = 437 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = +2 Query: 14 GSSSHEEIRDEGEAKRDLRSSGLCLVPLSCMSYITSESLG--VWPP-PNFGGR 163 G H++ D E KRDL+S GLCLVPLSCMSY+T + G +WPP PNFGGR Sbjct: 385 GLKDHQD--DNEETKRDLKSRGLCLVPLSCMSYVTGDGGGESIWPPVPNFGGR 435 >ref|XP_002281118.2| PREDICTED: transcription factor bHLH110-like [Vitis vinifera] gi|302142540|emb|CBI19743.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSE--SLGVWPPPNFGGRT 166 E +RDLRS GLCLVPLSCMSY+T++ GVWPPP+FGG T Sbjct: 387 EPRRDLRSRGLCLVPLSCMSYVTTDCGGGGVWPPPSFGGGT 427 >emb|CAN61992.1| hypothetical protein VITISV_030445 [Vitis vinifera] Length = 512 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSE--SLGVWPPPNFGGRT 166 E +RDLRS GLCLVPLSCMSY+T++ GVWPPP+FGG T Sbjct: 412 EPRRDLRSRGLCLVPLSCMSYVTTDCGGGGVWPPPSFGGGT 452 >ref|XP_006341970.1| PREDICTED: transcription factor bHLH110-like [Solanum tuberosum] Length = 406 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGGRT 166 E KRDLRS GLCLVPL+C++Y+T GVWPPPNF G T Sbjct: 368 EMKRDLRSRGLCLVPLTCLTYVTEGGGGVWPPPNFTGGT 406 >ref|XP_004238285.1| PREDICTED: transcription factor bHLH110-like [Solanum lycopersicum] Length = 405 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGGRT 166 E KRDLRS GLCLVPL+C++Y+T GVWPPPNF G T Sbjct: 367 EMKRDLRSRGLCLVPLTCLTYVTEGGGGVWPPPNFTGGT 405 >ref|XP_002307676.2| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] gi|550339708|gb|EEE94672.2| hypothetical protein POPTR_0005s25240g [Populus trichocarpa] Length = 419 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = +2 Query: 59 RDLRSSGLCLVPLSCMSYITSE--SLGVWPPPNFGGRT 166 RDLRS GLCLVPLSCMSY+T++ G+WPPPNFGG T Sbjct: 382 RDLRSRGLCLVPLSCMSYVTTDGGGGGIWPPPNFGGGT 419 >ref|XP_006643643.1| PREDICTED: uncharacterized protein LOC102705754 [Oryza brachyantha] Length = 393 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 44 EGEAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGG 160 E AK DLRS GLCLVPLSC SY+T+E+ GVWPPPNF G Sbjct: 355 EAAAKLDLRSRGLCLVPLSCTSYVTNEN-GVWPPPNFRG 392 >ref|XP_007017613.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] gi|508722941|gb|EOY14838.1| Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 1 [Theobroma cacao] Length = 425 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = +2 Query: 8 HEGSSSHEEIRDEGEAKRDLRSSGLCLVPLSCMSYITSES-LGVW--PPPNFGGRT 166 ++G S+ E+ +E KRDLRS GLCLVPLSCMSY+T++S G+W PPPNF G T Sbjct: 372 NQGGSTMEDGNEE--PKRDLRSRGLCLVPLSCMSYVTNDSGGGIWPPPPPNFSGGT 425 >ref|XP_004164011.1| PREDICTED: transcription factor bHLH110-like [Cucumis sativus] Length = 427 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = +2 Query: 23 SHEEIRDEGEAKRDLRSSGLCLVPLSCMSYITSES---LGVWPPPNFGGRT 166 S E +EG RDLRS GLCLVPL C+SY+T +S +G+WPPP F G T Sbjct: 376 SSVEDGNEGGQNRDLRSRGLCLVPLGCLSYVTGDSGGGVGIWPPPGFNGGT 426 >ref|XP_004147875.1| PREDICTED: transcription factor bHLH110-like [Cucumis sativus] Length = 458 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = +2 Query: 23 SHEEIRDEGEAKRDLRSSGLCLVPLSCMSYITSES---LGVWPPPNFGGRT 166 S E +EG RDLRS GLCLVPL C+SY+T +S +G+WPPP F G T Sbjct: 407 SSVEDGNEGGQNRDLRSRGLCLVPLGCLSYVTGDSGGGVGIWPPPGFNGGT 457 >ref|XP_002510430.1| transcription factor, putative [Ricinus communis] gi|223551131|gb|EEF52617.1| transcription factor, putative [Ricinus communis] Length = 436 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 4/43 (9%) Frame = +2 Query: 50 EAKRDLRSSGLCLVPLSCMSYITSESLG----VWPPPNFGGRT 166 E K+DLRS GLCLVPLSCMSY+T + G +WPPP+FGG T Sbjct: 394 EPKKDLRSRGLCLVPLSCMSYVTGDGGGSSGNIWPPPSFGGGT 436 >dbj|BAD44875.1| putative ethylene-responsive protein [Oryza sativa Japonica Group] gi|222617580|gb|EEE53712.1| hypothetical protein OsJ_00043 [Oryza sativa Japonica Group] Length = 387 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 44 EGEAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGG 160 + AK DLRS GLCLVPLSC SY+T+E+ GVWPPPNF G Sbjct: 349 DAAAKLDLRSRGLCLVPLSCTSYVTNEN-GVWPPPNFRG 386 >gb|EEC69777.1| hypothetical protein OsI_00047 [Oryza sativa Indica Group] Length = 387 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 44 EGEAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGG 160 + AK DLRS GLCLVPLSC SY+T+E+ GVWPPPNF G Sbjct: 349 DAAAKLDLRSRGLCLVPLSCTSYVTNEN-GVWPPPNFRG 386 >ref|NP_001041771.1| Os01g0105700 [Oryza sativa Japonica Group] gi|113531302|dbj|BAF03685.1| Os01g0105700 [Oryza sativa Japonica Group] Length = 388 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 44 EGEAKRDLRSSGLCLVPLSCMSYITSESLGVWPPPNFGG 160 + AK DLRS GLCLVPLSC SY+T+E+ GVWPPPNF G Sbjct: 350 DAAAKLDLRSRGLCLVPLSCTSYVTNEN-GVWPPPNFRG 387