BLASTX nr result
ID: Sinomenium21_contig00021543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00021543 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 108 6e-22 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 79 2e-17 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 73 5e-11 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 108 bits (271), Expect = 6e-22 Identities = 53/59 (89%), Positives = 53/59 (89%) Frame = +1 Query: 220 MGQRIKRFDFVPRDPPQVGFESRVMGDYPARFGEHL*SALVNGSPPIKQERSGSSHGGV 396 MGQRIKRFDFV RD PQVGFESRVMGDYPARFGEH SALVNGSP IKQERSG SHGGV Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHGGV 59 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 79.3 bits (194), Expect(2) = 2e-17 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 354 GASIHQRRLQVLSEPCWIVTHHTALKPNLWWIPGDKV 244 GASIHQRRL+VLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 35.4 bits (80), Expect(2) = 2e-17 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 398 VTPPWEEPLLSCLMGG 351 VTPPWEEPLLSCL+ G Sbjct: 2 VTPPWEEPLLSCLIVG 17 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/59 (66%), Positives = 39/59 (66%) Frame = +1 Query: 220 MGQRIKRFDFVPRDPPQVGFESRVMGDYPARFGEHL*SALVNGSPPIKQERSGSSHGGV 396 MGQRIKRFDFV RD PQVGFESRVMGDYPARFGE SG SHGGV Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE-----------------SGYSHGGV 42 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/59 (55%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -3 Query: 363 LDGGASIHQRRLQVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPPIK 190 L G SI Q RL+VL EPC I+T++T GD VKALDPLPHTL+ SS PIK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72