BLASTX nr result
ID: Sinomenium21_contig00021467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00021467 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precu... 68 3e-14 ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast prec... 64 6e-14 gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus lon... 65 7e-14 ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatu... 67 7e-14 ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chlor... 65 7e-14 emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sat... 67 8e-14 gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimoc... 65 8e-14 emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis t... 62 1e-13 ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana... 62 1e-13 gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana] 62 1e-13 gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana] 62 1e-13 ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arab... 62 1e-13 ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Caps... 65 1e-13 gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bun... 62 1e-13 ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobro... 65 2e-13 gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicu... 64 2e-13 emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus] 61 2e-13 gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis th... 61 3e-13 sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase,... 60 5e-13 emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea] 60 5e-13 >gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum] Length = 499 Score = 68.2 bits (165), Expect(2) = 3e-14 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAERLLELYHGKW Q VDHV EELLY Sbjct: 462 NAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY 499 Score = 35.4 bits (80), Expect(2) = 3e-14 Identities = 14/21 (66%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AE+V++L KDGLERRG+K++G Sbjct: 439 AEEVLELAKDGLERRGFKESG 459 >ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus communis] gi|223549699|gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus communis] Length = 526 Score = 63.5 bits (153), Expect(2) = 6e-14 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 242 LNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 + EVVRTGVTPAERLLELY+GKWGQ VD V EELLY Sbjct: 491 VTEVVRTGVTPAERLLELYNGKWGQSVDPVFEELLY 526 Score = 39.3 bits (90), Expect(2) = 6e-14 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 466 AEDVLKLAKDGLERRGYKEIG 486 >gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan] Length = 511 Score = 65.5 bits (158), Expect(2) = 7e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAE+LLE+YHGKWGQ VD V EELLY Sbjct: 474 NAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY 511 Score = 37.0 bits (84), Expect(2) = 7e-14 Identities = 14/21 (66%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 A+D++KL KDGLERRG+K++G Sbjct: 451 AQDILKLAKDGLERRGFKESG 471 >ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatula] gi|11386873|sp|Q9ZNX6.1|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gi|3941322|gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula] gi|355524534|gb|AET04988.1| Glutamate-cysteine ligase [Medicago truncatula] Length = 508 Score = 67.0 bits (162), Expect(2) = 7e-14 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAERLLELYHGKW Q VDHV +ELLY Sbjct: 471 NAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY 508 Score = 35.4 bits (80), Expect(2) = 7e-14 Identities = 14/21 (66%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AE+V++L KDGLERRG+K++G Sbjct: 448 AEEVLELAKDGLERRGFKESG 468 >ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer arietinum] Length = 504 Score = 65.5 bits (158), Expect(2) = 7e-14 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAERLLELY+GKW Q VDHV EELLY Sbjct: 467 NAVAEVVRTGVTPAERLLELYNGKWEQSVDHVFEELLY 504 Score = 37.0 bits (84), Expect(2) = 7e-14 Identities = 15/21 (71%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AE+V+KL KDGLERRG+K++G Sbjct: 444 AEEVLKLAKDGLERRGFKESG 464 >emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sativa] Length = 206 Score = 67.0 bits (162), Expect(2) = 8e-14 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAERLLELYHGKW Q VDHV +ELLY Sbjct: 169 NAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY 206 Score = 35.4 bits (80), Expect(2) = 8e-14 Identities = 14/21 (66%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AE+V++L KDGLERRG+K++G Sbjct: 146 AEEVLELAKDGLERRGFKESG 166 >gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimocarpus longan] Length = 78 Score = 65.5 bits (158), Expect(2) = 8e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAE+LLE+YHGKWGQ VD V EELLY Sbjct: 41 NAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY 78 Score = 37.0 bits (84), Expect(2) = 8e-14 Identities = 14/21 (66%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 A+D++KL KDGLERRG+K++G Sbjct: 18 AQDILKLAKDGLERRGFKESG 38 >emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana] Length = 522 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 485 NAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 462 AEDVLKLAKDGLERRGYKEAG 482 >ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana] gi|334186834|ref|NP_001190808.1| glutamate-cysteine ligase [Arabidopsis thaliana] gi|12644273|sp|P46309.2|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; AltName: Full=Protein ROOT MERISTEMLESS 1; Short=AtGCL; AltName: Full=Protein cadmium-sensitive 2; AltName: Full=Protein phytoalexin-deficient 2; Flags: Precursor gi|16930445|gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana] gi|3292836|emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana] gi|4262277|gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana] gi|7269157|emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana] gi|23506099|gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana] gi|332659306|gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana] gi|332659308|gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana] Length = 522 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 485 NAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 462 AEDVLKLAKDGLERRGYKEAG 482 >gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana] Length = 522 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 485 NAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 462 AEDVLKLAKDGLERRGYKEAG 482 >gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana] Length = 522 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 485 NAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 462 AEDVLKLAKDGLERRGYKEAG 482 >ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. lyrata] gi|297313566|gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. lyrata] Length = 520 Score = 62.4 bits (150), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 483 NAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY 520 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 460 AEDVLKLAKDGLERRGYKEAG 480 >ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Capsella rubella] gi|482552238|gb|EOA16431.1| hypothetical protein CARUB_v10004582mg [Capsella rubella] Length = 525 Score = 64.7 bits (156), Expect(2) = 1e-13 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAE+LLE+YHG+WGQ VD V EELLY Sbjct: 488 NAVTEVVRTGVTPAEKLLEMYHGEWGQSVDPVFEELLY 525 Score = 37.0 bits (84), Expect(2) = 1e-13 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+K KDGLERRGYK+ G Sbjct: 465 AEDVLKHAKDGLERRGYKEAG 485 >gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana] Length = 524 Score = 62.0 bits (149), Expect(2) = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVRTGVTPAE+LLELY+G+WGQ VD V +ELLY Sbjct: 487 NAVSEVVRTGVTPAEKLLELYNGEWGQSVDPVFQELLY 524 Score = 39.7 bits (91), Expect(2) = 1e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 464 AEDVLKLAKDGLERRGYKEAG 484 >ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao] gi|590678173|ref|XP_007040226.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao] gi|508777470|gb|EOY24726.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao] gi|508777471|gb|EOY24727.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao] Length = 525 Score = 65.1 bits (157), Expect(2) = 2e-13 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ +VVRTGVTPAE+LLELYHGKWGQ VD V EELLY Sbjct: 488 NAVADVVRTGVTPAEKLLELYHGKWGQSVDPVFEELLY 525 Score = 36.2 bits (82), Expect(2) = 2e-13 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+ L KDGLERRG+K++G Sbjct: 465 AEDVLTLAKDGLERRGFKESG 485 >gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus] gi|37681494|gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus] Length = 495 Score = 63.9 bits (154), Expect(2) = 2e-13 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -2 Query: 236 EVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 EVVRTGVTPAERLLELY GKW Q VDHV EELLY Sbjct: 462 EVVRTGVTPAERLLELYDGKWNQSVDHVFEELLY 495 Score = 37.4 bits (85), Expect(2) = 2e-13 Identities = 15/21 (71%), Positives = 20/21 (95%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLE+RG+K++G Sbjct: 435 AEDVLKLAKDGLEKRGFKESG 455 >emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus] Length = 514 Score = 61.2 bits (147), Expect(2) = 2e-13 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +AL EVVRTGVTPAE LLE+Y+G+WGQ VD V +ELLY Sbjct: 477 NALTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 514 Score = 39.7 bits (91), Expect(2) = 2e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 454 AEDVLKLAKDGLERRGYKEAG 474 >gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana] Length = 522 Score = 60.8 bits (146), Expect(2) = 3e-13 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A++EVVR+GVTPAE+LLE+Y+G+WGQ VD V EELLY Sbjct: 485 NAVDEVVRSGVTPAEKLLEMYNGEWGQSVDPVFEELLY 522 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 462 AEDVLKLAKDGLERRGYKEAG 482 >sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gi|2243126|emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea] gi|31043668|emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea] Length = 514 Score = 60.1 bits (144), Expect(2) = 5e-13 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAE LLE+Y+G+WGQ VD V +ELLY Sbjct: 477 NAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 514 Score = 39.7 bits (91), Expect(2) = 5e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 454 AEDVLKLAKDGLERRGYKEVG 474 >emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea] Length = 511 Score = 60.1 bits (144), Expect(2) = 5e-13 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 248 DALNEVVRTGVTPAERLLELYHGKWGQCVDHVHEELLY 135 +A+ EVVRTGVTPAE LLE+Y+G+WGQ VD V +ELLY Sbjct: 474 NAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY 511 Score = 39.7 bits (91), Expect(2) = 5e-13 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 309 AEDVVKLGKDGLERRGYKQTG 247 AEDV+KL KDGLERRGYK+ G Sbjct: 451 AEDVLKLAKDGLERRGYKEAG 471