BLASTX nr result
ID: Sinomenium21_contig00021036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00021036 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prun... 62 8e-08 ref|XP_006585305.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004296690.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_006354698.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_004504032.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006428072.1| hypothetical protein CICLE_v10025440mg [Citr... 57 2e-06 ref|XP_002532046.1| pentatricopeptide repeat-containing protein,... 56 5e-06 ref|XP_007048085.1| Tetratricopeptide repeat (TPR)-like superfam... 56 6e-06 >ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Solanum lycopersicum] Length = 478 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFG 212 +MKEL++KLLTYMD+DGI+PNKKFFL+ALGAFG Sbjct: 424 DMKELVQKLLTYMDEDGIIPNKKFFLDALGAFG 456 >ref|XP_007212021.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] gi|462407886|gb|EMJ13220.1| hypothetical protein PRUPE_ppa004899mg [Prunus persica] Length = 486 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFGLKAGTESSDSKINSTTEL 158 NMKEL+EKLL MDKDGIVPNK+FFLEALGAF G+ S + +TT L Sbjct: 430 NMKELLEKLLKCMDKDGIVPNKRFFLEALGAFFSSPGSPGS---VTATTGL 477 >ref|XP_006585305.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Length = 526 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAF-GLKAGTESSDSKINSTT 164 N KEL++KLL +MDKDGI+PNK+FFL+ALGA L A +ES+++ +S T Sbjct: 417 NQKELLDKLLKHMDKDGIIPNKRFFLDALGAVASLPANSESANAATDSNT 466 >ref|XP_004296690.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 420 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFGLKAGTESSDS 182 NMK+L++KLL MDKDGIVPNK+FFLEALGAF G S S Sbjct: 363 NMKDLLDKLLKSMDKDGIVPNKRFFLEALGAFLSSTGNSESGS 405 >ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Length = 503 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAF-GLKAGTESSDSKINSTT 164 N KEL++KLL +MDKDGIVPNK+FFL+ALGA L A +ES+++ +S T Sbjct: 408 NQKELLDKLLKHMDKDGIVPNKRFFLDALGAVASLPANSESANAATDSKT 457 >ref|XP_006354698.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565376411|ref|XP_006354699.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565376413|ref|XP_006354700.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 457 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFG 212 +MKEL++KLLT MD+DGI+PNKKFFL+ALGAFG Sbjct: 403 DMKELVQKLLTCMDEDGIIPNKKFFLDALGAFG 435 >ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Vitis vinifera] gi|296082481|emb|CBI21486.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFGLK-AGTESSDSKINSTTELIGAKT 143 + KEL+EKLL MD DGI+PNK+FFLEALGAFG A ES+ S T AKT Sbjct: 433 DQKELLEKLLKLMDSDGILPNKRFFLEALGAFGSSPASQESAGSTTGLTRPRNSAKT 489 >ref|XP_004504032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X1 [Cicer arietinum] gi|502140047|ref|XP_004504033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like isoform X2 [Cicer arietinum] Length = 477 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFGLKAGTESSDS 182 N KEL++KLL +MDKDG++PNK+FFL+ALGA G + TE S S Sbjct: 417 NSKELLDKLLKHMDKDGVIPNKRFFLDALGAIG--SSTEKSGS 457 >ref|XP_006428072.1| hypothetical protein CICLE_v10025440mg [Citrus clementina] gi|568819570|ref|XP_006464322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Citrus sinensis] gi|557530062|gb|ESR41312.1| hypothetical protein CICLE_v10025440mg [Citrus clementina] Length = 500 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFGLK-AGTESSDSKINSTTELIGAKT 143 NMKEL++KLL M+++GIVPNK+FFLEAL F AG++S +K + T L AK+ Sbjct: 444 NMKELVQKLLKRMEQNGIVPNKRFFLEALETFSSSLAGSQSGSAKTDLTRSLSTAKS 500 >ref|XP_002532046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528289|gb|EEF30336.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 478 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAF 215 NMK+L++KLL +MD+DGI+PNK+FFL+ALGAF Sbjct: 431 NMKKLVQKLLKHMDRDGIIPNKRFFLDALGAF 462 >ref|XP_007048085.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590707730|ref|XP_007048086.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508700346|gb|EOX92242.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508700347|gb|EOX92243.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 488 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 310 NMKELIEKLLTYMDKDGIVPNKKFFLEALGAFG-LKAGTESSDSKINSTTE 161 NMK+L++KL+ M+KDGIVPNK+FFLEAL AFG L A +S + I E Sbjct: 427 NMKDLMQKLVKQMEKDGIVPNKRFFLEALEAFGSLPASPDSVSATIGDRPE 477