BLASTX nr result
ID: Sinomenium21_contig00020751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00020751 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024650.1| Uncharacterized protein TCM_029154 [Theobrom... 61 2e-07 ref|XP_002534567.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_007024650.1| Uncharacterized protein TCM_029154 [Theobroma cacao] gi|508780016|gb|EOY27272.1| Uncharacterized protein TCM_029154 [Theobroma cacao] Length = 133 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/99 (34%), Positives = 54/99 (54%) Frame = -1 Query: 442 PSVRLGGKERKRGTPVFSXXXXXXXXXXXXXXLQYVCLFKKLKSYYYSVVGDLIEAGATV 263 P+VRLGGK+ +RG + QY C+ +KL+ YY +++ D++EAGA+V Sbjct: 38 PTVRLGGKKPRRGLFIVRILKKIRLRWLKL---QYTCMLRKLRKYYRNLIKDIVEAGASV 94 Query: 262 QTILNRIMTESQGGVPMIGVAAVAAAVPSKIESGTGLNR 146 + + R+ ES VP++GV+ S S TG +R Sbjct: 95 EALQQRMFMESTFAVPVLGVSF------SSFPSATGSDR 127 >ref|XP_002534567.1| conserved hypothetical protein [Ricinus communis] gi|223525015|gb|EEF27816.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/79 (34%), Positives = 47/79 (59%) Frame = -1 Query: 442 PSVRLGGKERKRGTPVFSXXXXXXXXXXXXXXLQYVCLFKKLKSYYYSVVGDLIEAGATV 263 P++RLGGK+ +RG+ + QY C+ +KLK YY +++ D++EAGAT+ Sbjct: 33 PTLRLGGKKPRRGSFLIRVLRKVRLKWLKL---QYSCMLRKLKEYYRNLIKDVVEAGATI 89 Query: 262 QTILNRIMTESQGGVPMIG 206 + R++ E+ VP++G Sbjct: 90 EVYQQRLVMEASLAVPVLG 108