BLASTX nr result
ID: Sinomenium21_contig00020383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00020383 (736 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT11946.1| hypothetical protein F775_30464 [Aegilops tauschii] 70 6e-10 gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum... 70 1e-09 gb|EMT26300.1| Nuclear pore complex protein [Aegilops tauschii] 63 1e-07 >gb|EMT11946.1| hypothetical protein F775_30464 [Aegilops tauschii] Length = 562 Score = 70.5 bits (171), Expect = 6e-10 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +2 Query: 131 RRGALVQW*ELWPCDIEVMGLSHGNSLLLREVRLLTINPKWSDPSPYPTYAGASCTG 301 ++G+L +L PCD EVMG S GNSLL + RL TI+PKWSDPSP P AGA+CTG Sbjct: 351 KKGSLGAVVKLLPCDHEVMGSSPGNSLLQKWERLRTIDPKWSDPSPDPAQAGATCTG 407 >gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu] Length = 1047 Score = 69.7 bits (169), Expect = 1e-09 Identities = 36/57 (63%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +2 Query: 158 ELWPCDIEVMGLSHGNSLLLR-EVRLLTINPKWSDPSPYPTYAGASCTGLPFMCVYK 325 EL PCD EV G S GNSLL + RL TI+ KWSDPSP P AGA+CTGLPF+ + K Sbjct: 634 ELLPCDHEVTGSSPGNSLLQKCRDRLRTIDAKWSDPSPDPGQAGATCTGLPFLYILK 690 >gb|EMT26300.1| Nuclear pore complex protein [Aegilops tauschii] Length = 1176 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 137 GALVQW*ELWPCDIEVMGLSHGNSLLLR-EVRLLTINPKWSDPSPYPTYAGASCTGLP 307 GA+V+ L PCD EV G S GNSLL + L TI+PKWSDP P P AGA+CTGLP Sbjct: 530 GAVVK---LLPCDHEVTGSSPGNSLLQKCREGLRTIDPKWSDPFPDPAQAGATCTGLP 584