BLASTX nr result
ID: Sinomenium21_contig00020352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00020352 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515759.1| Vesicle-associated membrane protein, putativ... 57 3e-06 ref|XP_004974203.1| PREDICTED: vesicle-associated membrane prote... 56 5e-06 >ref|XP_002515759.1| Vesicle-associated membrane protein, putative [Ricinus communis] gi|223545087|gb|EEF46598.1| Vesicle-associated membrane protein, putative [Ricinus communis] Length = 237 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 2 QNLKLKLMVGGALLAVIVILWLMVCRGFKC 91 QNL++KLM+GGA+L +IVILWL+VCRGFKC Sbjct: 208 QNLQMKLMIGGAILVLIVILWLLVCRGFKC 237 >ref|XP_004974203.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X1 [Setaria italica] gi|514798530|ref|XP_004974204.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X2 [Setaria italica] Length = 239 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 QNLKLKLMVGGALLAVIVILWLMVCRGFKC 91 QNL+ KLMVGGA+ A+I+ILWLMVCRGFKC Sbjct: 210 QNLRFKLMVGGAIAALILILWLMVCRGFKC 239