BLASTX nr result
ID: Sinomenium21_contig00020189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00020189 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222232.1| hypothetical protein PRUPE_ppa007907mg [Prun... 55 9e-06 >ref|XP_007222232.1| hypothetical protein PRUPE_ppa007907mg [Prunus persica] gi|462419168|gb|EMJ23431.1| hypothetical protein PRUPE_ppa007907mg [Prunus persica] Length = 351 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 414 PCNQGDPAWAISSETINSLVCLSLNFFFILPLNSQLT 524 P GDP WAISS+T+NSLV LSLNFFFILPL + +T Sbjct: 121 PYAPGDPVWAISSDTVNSLVGLSLNFFFILPLLNSVT 157