BLASTX nr result
ID: Sinomenium21_contig00018684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00018684 (730 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516874.1| PREDICTED: HD domain-containing protein 2-li... 56 2e-06 gb|AFK41788.1| unknown [Lotus japonicus] 54 7e-06 ref|XP_003518821.1| PREDICTED: HD domain-containing protein 2-li... 56 9e-06 >ref|XP_003516874.1| PREDICTED: HD domain-containing protein 2-like [Glycine max] Length = 261 Score = 55.8 bits (133), Expect(2) = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 477 FLSTAGKFQTEIGESWAAEIISRRKSMLSKK 385 FLSTAGKFQTEIG+SWAAEIISRRKS+ +K+ Sbjct: 229 FLSTAGKFQTEIGKSWAAEIISRRKSLSAKR 259 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 505 TEQGKVLDEF 476 TE GKVLDEF Sbjct: 219 TEHGKVLDEF 228 >gb|AFK41788.1| unknown [Lotus japonicus] Length = 239 Score = 54.3 bits (129), Expect(2) = 7e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 477 FLSTAGKFQTEIGESWAAEIISRRKSMLSKKL 382 FLSTAGKFQTEIG+SWA+EIISRRKS+ + +L Sbjct: 207 FLSTAGKFQTEIGKSWASEIISRRKSLSANRL 238 Score = 22.3 bits (46), Expect(2) = 7e-06 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 511 CLTEQGKVLDEF 476 C E GKVLDEF Sbjct: 195 CEMEHGKVLDEF 206 >ref|XP_003518821.1| PREDICTED: HD domain-containing protein 2-like [Glycine max] Length = 269 Score = 55.8 bits (133), Expect(2) = 9e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 477 FLSTAGKFQTEIGESWAAEIISRRKSMLSKK 385 FLSTAGKFQTEIG+SWAAEIISRRKS+ +K+ Sbjct: 233 FLSTAGKFQTEIGKSWAAEIISRRKSLSAKR 263 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 502 EQGKVLDEF 476 E GKVLDEF Sbjct: 224 EHGKVLDEF 232