BLASTX nr result
ID: Sinomenium21_contig00018663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00018663 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305125.1| PREDICTED: uncharacterized protein LOC101312... 58 2e-06 >ref|XP_004305125.1| PREDICTED: uncharacterized protein LOC101312178 [Fragaria vesca subsp. vesca] Length = 1122 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = -1 Query: 125 MLAKRLLQKI--RHPHSQHNLQHGSLTSIDLDVNVALHYGIPS 3 M AKRLL K H HSQ N+Q GSLTS DLD+ VA+HYGIPS Sbjct: 1 MFAKRLLHKAVNHHHHSQQNMQQGSLTSADLDLRVAVHYGIPS 43