BLASTX nr result
ID: Sinomenium21_contig00018407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00018407 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006837842.1| hypothetical protein AMTR_s00100p00042880 [A... 55 8e-06 >ref|XP_006837842.1| hypothetical protein AMTR_s00100p00042880 [Amborella trichopoda] gi|548840211|gb|ERN00411.1| hypothetical protein AMTR_s00100p00042880 [Amborella trichopoda] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/50 (60%), Positives = 31/50 (62%) Frame = -3 Query: 293 DDDEQVLFSILDIFCAHAKRLKNMKRKT*QAKALENAKKVPRTFMELLHE 144 DDDE D K+ KN KRKT QAKALENAKK PRTF ELL E Sbjct: 57 DDDEDASLDEEDEVYIQKKQAKNTKRKTRQAKALENAKKAPRTFQELLQE 106