BLASTX nr result
ID: Sinomenium21_contig00017962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00017962 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382382.1| hypothetical protein POPTR_0005s01610g [Popu... 59 7e-07 ref|XP_006387432.1| hypothetical protein POPTR_1042s00200g [Popu... 56 5e-06 >ref|XP_006382382.1| hypothetical protein POPTR_0005s01610g [Populus trichocarpa] gi|550337742|gb|ERP60179.1| hypothetical protein POPTR_0005s01610g [Populus trichocarpa] Length = 977 Score = 58.9 bits (141), Expect = 7e-07 Identities = 39/89 (43%), Positives = 51/89 (57%), Gaps = 1/89 (1%) Frame = -3 Query: 325 LSYNNFNSSIFTSLSGAFPSLKELYLYRNEFRNGMQ-GSLDILSHGLKRLEKLDLSLHGY 149 L+ N FN SI TSLSG F +LK LYL N F + +L+ GL+ LE+LDLS + Sbjct: 96 LNDNKFNDSILTSLSG-FSTLKSLYLSNNRFTVTIDLKGFQVLASGLRNLEQLDLSYNKL 154 Query: 148 DISNMSFLGALPSLKELSLVFDAFNGSLG 62 + S +S L +LK L L + F GS G Sbjct: 155 NDSVLSSLSGFSTLKFLDLSNNRFTGSTG 183 >ref|XP_006387432.1| hypothetical protein POPTR_1042s00200g [Populus trichocarpa] gi|550307087|gb|ERP46346.1| hypothetical protein POPTR_1042s00200g [Populus trichocarpa] Length = 293 Score = 56.2 bits (134), Expect = 5e-06 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 2/88 (2%) Frame = -3 Query: 325 LSYNNFNSSIFTSLSGAFPSLKELYLYRNEFRN--GMQGSLDILSHGLKRLEKLDLSLHG 152 L N +N SIF++L+G F SLK L L N+ G G D L L+ LE LDLS + Sbjct: 191 LKMNGYNDSIFSTLTG-FSSLKSLDLSYNQLTGSAGFNG-FDALPSKLRELESLDLSYNR 248 Query: 151 YDISNMSFLGALPSLKELSLVFDAFNGS 68 ++ S++S+L PSLK L+L + F GS Sbjct: 249 FNDSDLSYLCEFPSLKSLNLSGNMFLGS 276