BLASTX nr result
ID: Sinomenium21_contig00017226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00017226 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 117 1e-24 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 117 1e-24 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 116 4e-24 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 115 5e-24 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 115 6e-24 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 115 6e-24 gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] 115 8e-24 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 115 8e-24 gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Mimulus... 114 1e-23 gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium of... 114 1e-23 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 114 1e-23 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 114 1e-23 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 114 1e-23 dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] 114 1e-23 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 114 1e-23 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 114 2e-23 ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prun... 113 2e-23 gb|AFV29350.1| calcium-dependent protein kinase-like protein, pa... 113 2e-23 gb|AFV29312.1| calcium-dependent protein kinase-like protein, pa... 113 2e-23 gb|AFV29292.1| calcium-dependent protein kinase-like protein, pa... 113 2e-23 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 117 bits (294), Expect = 1e-24 Identities = 57/65 (87%), Positives = 62/65 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EV++AI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSLKLM+DGSLQL Sbjct: 468 EVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 Query: 81 SNEGR 67 +NEGR Sbjct: 528 TNEGR 532 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 117 bits (294), Expect = 1e-24 Identities = 57/65 (87%), Positives = 62/65 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDG+ISYEEF TMMKAGTDWRKASRQYSRERFNSLSLKLM+DGSL+L Sbjct: 464 EVINAIINDVDTDKDGKISYEEFTTMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLKL 523 Query: 81 SNEGR 67 +NEGR Sbjct: 524 ANEGR 528 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 116 bits (290), Expect = 4e-24 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFN+LSLKL+KDGSLQ Sbjct: 465 EVINAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQS 524 Query: 81 SNEGR 67 +NEGR Sbjct: 525 ANEGR 529 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 115 bits (289), Expect = 5e-24 Identities = 56/64 (87%), Positives = 61/64 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EV++AI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSLKLM+DGSLQL Sbjct: 468 EVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 Query: 81 SNEG 70 +NEG Sbjct: 528 TNEG 531 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 115 bits (288), Expect = 6e-24 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDGRISY+EF+TMMK GTDWRKASRQYSRER+NSLSLKLMKDGSLQ+ Sbjct: 466 EVINAIMHDVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQM 525 Query: 81 SNEGR 67 SNE R Sbjct: 526 SNETR 530 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 115 bits (288), Expect = 6e-24 Identities = 57/69 (82%), Positives = 63/69 (91%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVI+AI+ DVD DKDGRISY+EFA MMKAGTDWRKASRQYSRERFN+LSLKLMKDGSLQ+ Sbjct: 471 EVISAIMHDVDTDKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQM 530 Query: 81 SNEGR*DNT 55 +NE R NT Sbjct: 531 NNEPRRPNT 539 >gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 530 Score = 115 bits (287), Expect = 8e-24 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDGRISYEEFATMMKAGTDWRKASRQYSRE FNSLSL+LMK+GSLQL Sbjct: 466 EVINAIMQDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRELFNSLSLRLMKEGSLQL 525 Query: 81 SNEGR 67 NE R Sbjct: 526 DNESR 530 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 115 bits (287), Expect = 8e-24 Identities = 55/64 (85%), Positives = 61/64 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 E+INAI+ DVD DKDGRISY+EFATMMKAGTDWRKASRQYSRERFN+LSLKLMKDGSLQ+ Sbjct: 467 EIINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQM 526 Query: 81 SNEG 70 +N G Sbjct: 527 NNGG 530 >gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Mimulus guttatus] Length = 533 Score = 114 bits (286), Expect = 1e-23 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVI AI+ DVD DKDGRISYEEFA+MMKAGTDWRKASRQYSRERFNSLSLKLMK+GSL L Sbjct: 469 EVIIAIMHDVDTDKDGRISYEEFASMMKAGTDWRKASRQYSRERFNSLSLKLMKEGSLHL 528 Query: 81 SNEGR 67 +NEGR Sbjct: 529 ANEGR 533 >gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium officinale] Length = 536 Score = 114 bits (286), Expect = 1e-23 Identities = 56/65 (86%), Positives = 60/65 (92%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDG+ISYEEFA MMKAGTDWRKASRQYSRERF SLSLKL+KDGSLQL Sbjct: 472 EVINAIIRDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFTSLSLKLIKDGSLQL 531 Query: 81 SNEGR 67 N+GR Sbjct: 532 KNDGR 536 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 114 bits (286), Expect = 1e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVI AI+ DVD DKDGRISY+EFA MMKAGTDWRKASRQYSRERFN+LSLKLM+DGSLQ+ Sbjct: 470 EVITAIMHDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQM 529 Query: 81 SNEGR 67 +NEGR Sbjct: 530 NNEGR 534 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 114 bits (285), Expect = 1e-23 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +V+NAI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSLKLM+DGSL L Sbjct: 466 DVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHL 525 Query: 81 SNEGR 67 +NE R Sbjct: 526 TNEAR 530 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 114 bits (285), Expect = 1e-23 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +V+NAI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSLKLM+DGSL L Sbjct: 467 DVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHL 526 Query: 81 SNEGR 67 +NE R Sbjct: 527 TNEAR 531 >dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] Length = 531 Score = 114 bits (285), Expect = 1e-23 Identities = 56/65 (86%), Positives = 62/65 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +VINAI+ DVD DKDGRISY+EFATMMKAGTDWRKASRQYSRERF++LSLKLMKDGSLQL Sbjct: 467 DVINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFSNLSLKLMKDGSLQL 526 Query: 81 SNEGR 67 +NE R Sbjct: 527 NNEVR 531 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 114 bits (285), Expect = 1e-23 Identities = 55/65 (84%), Positives = 62/65 (95%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +VINAI+ DVD DKDG+ISYEEFA MMKAGTDWRKASRQYSRERFN+LSLKLMKDGSL+L Sbjct: 468 DVINAIIHDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLKL 527 Query: 81 SNEGR 67 ++EGR Sbjct: 528 TSEGR 532 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 114 bits (284), Expect = 2e-23 Identities = 56/63 (88%), Positives = 59/63 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVINAI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSLKLM+DGSLQL Sbjct: 465 EVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 524 Query: 81 SNE 73 N+ Sbjct: 525 ENK 527 >ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] gi|462407598|gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] Length = 425 Score = 113 bits (283), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 EVI+AI+ DVD DKDGRISYEEFA MMKAGTDWRKASRQYSRERFNS+SLKLM++GSLQL Sbjct: 361 EVIHAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSISLKLMREGSLQL 420 Query: 81 SNEGR 67 + EGR Sbjct: 421 ATEGR 425 >gb|AFV29350.1| calcium-dependent protein kinase-like protein, partial [Senecio vulgaris] Length = 145 Score = 113 bits (283), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +VINAI+ DVD DKDGRISYEEFATMMK+GTDWRKASRQYSRERFN+LSLKLMKDGSL+L Sbjct: 81 DVINAIMHDVDTDKDGRISYEEFATMMKSGTDWRKASRQYSRERFNNLSLKLMKDGSLEL 140 Query: 81 SNEGR 67 NE + Sbjct: 141 VNEDK 145 >gb|AFV29312.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188907|gb|AFV29313.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188913|gb|AFV29316.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188915|gb|AFV29317.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188917|gb|AFV29318.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188919|gb|AFV29319.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188921|gb|AFV29320.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188923|gb|AFV29321.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188925|gb|AFV29322.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188927|gb|AFV29323.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188933|gb|AFV29326.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188935|gb|AFV29327.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188953|gb|AFV29336.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188955|gb|AFV29337.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188961|gb|AFV29340.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 113 bits (283), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +VINAI+ DVD DKDGRISYEEFATMMK+GTDWRKASRQYSRERFN+LSLKLMKDGSL+L Sbjct: 81 DVINAIMHDVDTDKDGRISYEEFATMMKSGTDWRKASRQYSRERFNNLSLKLMKDGSLEL 140 Query: 81 SNEGR 67 NE + Sbjct: 141 VNEDK 145 >gb|AFV29292.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] gi|409188867|gb|AFV29293.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis] Length = 145 Score = 113 bits (283), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -2 Query: 261 EVINAILCDVDYDKDGRISYEEFATMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQL 82 +VINAI+ DVD DKDGRISYEEFATMMK+GTDWRKASRQYSRERFN+LSLKLMKDGSL+L Sbjct: 81 DVINAIMHDVDTDKDGRISYEEFATMMKSGTDWRKASRQYSRERFNNLSLKLMKDGSLEL 140 Query: 81 SNEGR 67 NE + Sbjct: 141 VNEDK 145