BLASTX nr result
ID: Sinomenium21_contig00016660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00016660 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35385.1| unknown [Medicago truncatula] 60 4e-07 ref|XP_004505782.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 2e-06 gb|EXB39292.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Moru... 56 5e-06 >gb|AFK35385.1| unknown [Medicago truncatula] Length = 223 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +1 Query: 139 MRRELSRFLQPRYLLLLFVVAIVIYIAFPTSQPXXXXXXXXPDITHRVFLDIDIDGQ 309 MRRE++ QPR+L+LL V++I I AF +S+ P+ITHRVFLDIDID Q Sbjct: 1 MRREIAFLAQPRFLILLLVLSIFIIFAFSSSKLADEKTEEEPEITHRVFLDIDIDKQ 57 >ref|XP_004505782.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4-like [Cicer arietinum] Length = 223 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = +1 Query: 139 MRRELSRFLQPRYLLLLFVVAIVIYIAFPTSQPXXXXXXXXPDITHRVFLDIDIDGQ 309 MRRE++ QPR+LL+ V++I + AF S+ P+ITHRVFLDIDID Q Sbjct: 1 MRREIAFLAQPRFLLIFLVLSIFLIFAFSASKRADEESEEEPEITHRVFLDIDIDKQ 57 >gb|EXB39292.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Morus notabilis] Length = 225 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = +1 Query: 139 MRRELSRFLQPRYLLLLFVVAIVIYIAF--PTSQPXXXXXXXXPDITHRVFLDIDIDGQ 309 MRRE+S +QPR LLL V++I + AF P + P+ITHRV+LD+DIDGQ Sbjct: 1 MRREISFLIQPRCLLLFVVLSIFLIFAFSSPKREEVEEKVEEVPEITHRVYLDVDIDGQ 59