BLASTX nr result
ID: Sinomenium21_contig00016524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00016524 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] 115 8e-24 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 114 1e-23 gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium of... 114 2e-23 ref|XP_006489930.1| PREDICTED: calcium-dependent protein kinase ... 114 2e-23 ref|XP_006489929.1| PREDICTED: calcium-dependent protein kinase ... 114 2e-23 ref|XP_006421421.1| hypothetical protein CICLE_v10004707mg [Citr... 114 2e-23 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 113 2e-23 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 113 3e-23 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 113 3e-23 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 113 3e-23 gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 113 3e-23 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 112 4e-23 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 112 5e-23 gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] 112 5e-23 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 112 5e-23 gb|EYU46253.1| hypothetical protein MIMGU_mgv1a004318mg [Mimulus... 112 7e-23 gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus... 111 9e-23 ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase ... 111 9e-23 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 111 9e-23 ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase ... 111 1e-22 >dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] Length = 531 Score = 115 bits (287), Expect = 8e-24 Identities = 56/65 (86%), Positives = 63/65 (96%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 +VINAII DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRERF++LSL+L+KDGSLQL Sbjct: 467 DVINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFSNLSLKLMKDGSLQL 526 Query: 182 SNEVR 196 +NEVR Sbjct: 527 NNEVR 531 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 114 bits (285), Expect = 1e-23 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFN+LSL+LIKDGSLQ Sbjct: 465 EVINAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGSLQS 524 Query: 182 SNEVR 196 +NE R Sbjct: 525 ANEGR 529 >gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium officinale] Length = 536 Score = 114 bits (284), Expect = 2e-23 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAII DVDTDKDG+ISYEEFA MMKAGTDWRKASRQYSRERF SLSL+LIKDGSLQL Sbjct: 472 EVINAIIRDVDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFTSLSLKLIKDGSLQL 531 Query: 182 SNEVR 196 N+ R Sbjct: 532 KNDGR 536 >ref|XP_006489930.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X2 [Citrus sinensis] Length = 532 Score = 114 bits (284), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV+ AI+ DVDTDKDGRISYEEFA+MMKAGTDWRKASRQYSRERFNSLSL+L+KDGSLQ Sbjct: 468 EVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQS 527 Query: 182 SNEVR 196 +N VR Sbjct: 528 NNNVR 532 >ref|XP_006489929.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X1 [Citrus sinensis] Length = 536 Score = 114 bits (284), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV+ AI+ DVDTDKDGRISYEEFA+MMKAGTDWRKASRQYSRERFNSLSL+L+KDGSLQ Sbjct: 472 EVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQS 531 Query: 182 SNEVR 196 +N VR Sbjct: 532 NNNVR 536 >ref|XP_006421421.1| hypothetical protein CICLE_v10004707mg [Citrus clementina] gi|557523294|gb|ESR34661.1| hypothetical protein CICLE_v10004707mg [Citrus clementina] Length = 532 Score = 114 bits (284), Expect = 2e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV+ AI+ DVDTDKDGRISYEEFA+MMKAGTDWRKASRQYSRERFNSLSL+L+KDGSLQ Sbjct: 468 EVVTAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQS 527 Query: 182 SNEVR 196 +N VR Sbjct: 528 NNNVR 532 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 113 bits (283), Expect = 2e-23 Identities = 54/65 (83%), Positives = 63/65 (96%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVI+AI+ DVDTDKDGRISY+EFA+MMKAGTDWRKASRQYSRERFN+LSL+L+KDGSLQ+ Sbjct: 471 EVISAIMHDVDTDKDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQM 530 Query: 182 SNEVR 196 +NE R Sbjct: 531 NNEPR 535 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 113 bits (282), Expect = 3e-23 Identities = 54/65 (83%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 +V+NAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSL L Sbjct: 466 DVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHL 525 Query: 182 SNEVR 196 +NE R Sbjct: 526 TNEAR 530 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 113 bits (282), Expect = 3e-23 Identities = 54/65 (83%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 +V+NAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSL L Sbjct: 467 DVVNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHL 526 Query: 182 SNEVR 196 +NE R Sbjct: 527 TNEAR 531 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 113 bits (282), Expect = 3e-23 Identities = 55/65 (84%), Positives = 62/65 (95%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV++AI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSLQL Sbjct: 468 EVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 Query: 182 SNEVR 196 +NE R Sbjct: 528 TNEGR 532 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 113 bits (282), Expect = 3e-23 Identities = 54/65 (83%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAI+ DVDTDKDGRISY+EF+ MMK GTDWRKASRQYSRER+NSLSL+L+KDGSLQ+ Sbjct: 466 EVINAIMHDVDTDKDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQM 525 Query: 182 SNEVR 196 SNE R Sbjct: 526 SNETR 530 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 112 bits (281), Expect = 4e-23 Identities = 55/63 (87%), Positives = 60/63 (95%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSLQL Sbjct: 465 EVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 524 Query: 182 SNE 190 N+ Sbjct: 525 ENK 527 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 112 bits (280), Expect = 5e-23 Identities = 54/63 (85%), Positives = 61/63 (96%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV++AI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSLQL Sbjct: 468 EVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 Query: 182 SNE 190 +NE Sbjct: 528 TNE 530 >gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 530 Score = 112 bits (280), Expect = 5e-23 Identities = 56/65 (86%), Positives = 59/65 (90%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRE FNSLSL L+K+GSLQL Sbjct: 466 EVINAIMQDVDTDKDGRISYEEFATMMKAGTDWRKASRQYSRELFNSLSLRLMKEGSLQL 525 Query: 182 SNEVR 196 NE R Sbjct: 526 DNESR 530 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 112 bits (280), Expect = 5e-23 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAII DVDTDKDG+ISYEEF MMKAGTDWRKASRQYSRERFNSLSL+L++DGSL+L Sbjct: 464 EVINAIINDVDTDKDGKISYEEFTTMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLKL 523 Query: 182 SNEVR 196 +NE R Sbjct: 524 ANEGR 528 >gb|EYU46253.1| hypothetical protein MIMGU_mgv1a004318mg [Mimulus guttatus] Length = 533 Score = 112 bits (279), Expect = 7e-23 Identities = 54/65 (83%), Positives = 62/65 (95%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVI+AI+ DVDTDKDGRIS+EEFA+MMKAGTDWRKASRQYSRERFNSLSL+LIKDGS+ + Sbjct: 469 EVISAIMHDVDTDKDGRISFEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLIKDGSVDI 528 Query: 182 SNEVR 196 +NE R Sbjct: 529 ANEGR 533 >gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus guttatus] Length = 530 Score = 111 bits (278), Expect = 9e-23 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAII DVDTDKDGRIS+EEFA MMK+GTDWRKASRQYSRER+NSLSL+L+ DGSLQ+ Sbjct: 467 EVINAIIQDVDTDKDGRISFEEFAAMMKSGTDWRKASRQYSRERYNSLSLKLMTDGSLQM 526 Query: 182 SNE 190 SNE Sbjct: 527 SNE 529 >ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum] Length = 532 Score = 111 bits (278), Expect = 9e-23 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EVINAI+ DVDTDKDGRISYEEFA+MMKAGTDWRKASRQYSRERFNSLSL+L++DGS+Q+ Sbjct: 467 EVINAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQV 526 Query: 182 SNE 190 E Sbjct: 527 GKE 529 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 111 bits (278), Expect = 9e-23 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 E+INAII DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRERFN+LSL+L+KDGSLQ+ Sbjct: 467 EIINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQM 526 Query: 182 SN 187 +N Sbjct: 527 NN 528 >ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase 8-like [Solanum tuberosum] Length = 533 Score = 111 bits (277), Expect = 1e-22 Identities = 54/64 (84%), Positives = 60/64 (93%) Frame = +2 Query: 2 EVINAIIVDVDTDKDGRISYEEFAIMMKAGTDWRKASRQYSRERFNSLSLELIKDGSLQL 181 EV NAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRERFNSLSL+L++DGSLQ+ Sbjct: 470 EVTNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQV 529 Query: 182 SNEV 193 N+V Sbjct: 530 ENKV 533