BLASTX nr result
ID: Sinomenium21_contig00016057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00016057 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523161.1| ATP binding protein, putative [Ricinus commu... 58 1e-06 >ref|XP_002523161.1| ATP binding protein, putative [Ricinus communis] gi|223537568|gb|EEF39192.1| ATP binding protein, putative [Ricinus communis] Length = 831 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 6/76 (7%) Frame = -3 Query: 256 YLILFFFLINSRSAWPFSPADYYLLDCGSDLNTIVNIRDFVRDSSLFGPISLSATPNISL 77 +L L F + S S+ F+P D YLL+CGS NT ++ R FV DSS G LS +ISL Sbjct: 8 FLSLVFMSLLSSSSTSFTPTDNYLLNCGSTTNTSLDNRVFVSDSSKSGWFVLSTAQSISL 67 Query: 76 EDQNPS------HHSS 47 +QNPS HH++ Sbjct: 68 TNQNPSPNLPSLHHTA 83