BLASTX nr result
ID: Sinomenium21_contig00015708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00015708 (871 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 58 5e-06 gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis] 57 9e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 57.8 bits (138), Expect = 5e-06 Identities = 28/46 (60%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +2 Query: 143 PLKLKGKFYKTAIRPAMLYGTKYWAIKK*SIKKLKVMDI*VL--MC 274 PLKLKGKFY+TAIRPAMLYGT+ WA+K + K+ V ++ +L MC Sbjct: 838 PLKLKGKFYRTAIRPAMLYGTECWAVKHQHVHKMGVAEMRMLRWMC 883 >gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis] Length = 670 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +2 Query: 143 PLKLKGKFYKTAIRPAMLYGTKYWAIKK*SIKKLKVMDI*VL 268 P+KLKGKFY+T IRPAMLYG++ WAIK+ I K+ V+++ +L Sbjct: 514 PIKLKGKFYRTVIRPAMLYGSECWAIKRQHIAKMSVIEMRML 555