BLASTX nr result
ID: Sinomenium21_contig00015606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00015606 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006434088.1| hypothetical protein CICLE_v10002965mg [Citr... 57 3e-06 ref|XP_006434087.1| hypothetical protein CICLE_v10002965mg [Citr... 57 3e-06 >ref|XP_006434088.1| hypothetical protein CICLE_v10002965mg [Citrus clementina] gi|557536210|gb|ESR47328.1| hypothetical protein CICLE_v10002965mg [Citrus clementina] Length = 91 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/79 (37%), Positives = 38/79 (48%) Frame = +2 Query: 32 LGMDSPSFGDYLSLFVLRPXXXXXXXXXXXXXGWAMAWKLVLAHVPLVQEIRKSLXXXXX 211 + +S + +Y +LF+LRP GW +AWKLVL HVPL+QEI Sbjct: 8 IAANSLYYWNYFNLFLLRPILAISFALFFILLGWFLAWKLVLVHVPLIQEIFGMRKKPVI 67 Query: 212 XXXXXXXXLSRFYSGANAT 268 SRFY G NAT Sbjct: 68 PKPPLRRRFSRFYKGINAT 86 >ref|XP_006434087.1| hypothetical protein CICLE_v10002965mg [Citrus clementina] gi|557536209|gb|ESR47327.1| hypothetical protein CICLE_v10002965mg [Citrus clementina] Length = 92 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/79 (37%), Positives = 38/79 (48%) Frame = +2 Query: 32 LGMDSPSFGDYLSLFVLRPXXXXXXXXXXXXXGWAMAWKLVLAHVPLVQEIRKSLXXXXX 211 + +S + +Y +LF+LRP GW +AWKLVL HVPL+QEI Sbjct: 8 IAANSLYYWNYFNLFLLRPILAISFALFFILLGWFLAWKLVLVHVPLIQEIFGMRKKPVI 67 Query: 212 XXXXXXXXLSRFYSGANAT 268 SRFY G NAT Sbjct: 68 PKPPLRRRFSRFYKGINAT 86