BLASTX nr result
ID: Sinomenium21_contig00015479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00015479 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] 81 2e-13 ref|XP_004135926.1| PREDICTED: U6 snRNA-associated Sm-like prote... 81 2e-13 ref|XP_006358427.1| PREDICTED: U6 snRNA-associated Sm-like prote... 80 2e-13 ref|XP_006352785.1| PREDICTED: U6 snRNA-associated Sm-like prote... 80 2e-13 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 80 2e-13 ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containin... 80 2e-13 ref|XP_004242327.1| PREDICTED: U6 snRNA-associated Sm-like prote... 80 2e-13 ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citr... 80 4e-13 gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] 79 5e-13 ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like prote... 79 5e-13 ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containin... 79 5e-13 ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like prote... 79 5e-13 ref|XP_007212296.1| hypothetical protein PRUPE_ppa013967mg [Prun... 79 5e-13 ref|XP_007162394.1| hypothetical protein PHAVU_001G148500g [Phas... 79 7e-13 ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 79 7e-13 emb|CBI32330.3| unnamed protein product [Vitis vinifera] 79 7e-13 ref|NP_001236540.1| uncharacterized protein LOC100305778 [Glycin... 79 7e-13 ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Me... 79 7e-13 ref|XP_006384992.1| hypothetical protein POPTR_0004s22870g [Popu... 78 1e-12 gb|ABK93357.1| unknown [Populus trichocarpa] 78 1e-12 >gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] Length = 93 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_004135926.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 1 [Cucumis sativus] gi|449436293|ref|XP_004135927.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 2 [Cucumis sativus] gi|449436295|ref|XP_004135928.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 3 [Cucumis sativus] gi|449489026|ref|XP_004158193.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 1 [Cucumis sativus] gi|449489028|ref|XP_004158194.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 2 [Cucumis sativus] gi|449489032|ref|XP_004158195.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform 3 [Cucumis sativus] Length = 93 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_006358427.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum tuberosum] Length = 93 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_006352785.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum tuberosum] Length = 93 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 456 SVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 493 >ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 499 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 462 SVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 499 >ref|XP_004242327.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Solanum lycopersicum] Length = 93 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] gi|568852209|ref|XP_006479772.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Citrus sinensis] gi|557546399|gb|ESR57377.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] Length = 93 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPPDGVDV+LLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREARGG 93 >gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] Length = 140 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 103 SVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 140 >ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Cicer arietinum] gi|604348467|gb|EYU46622.1| hypothetical protein MIMGU_mgv1a017110mg [Mimulus guttatus] Length = 93 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Cicer arietinum] Length = 497 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 460 SVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 497 >ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Fragaria vesca subsp. vesca] Length = 93 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_007212296.1| hypothetical protein PRUPE_ppa013967mg [Prunus persica] gi|462408161|gb|EMJ13495.1| hypothetical protein PRUPE_ppa013967mg [Prunus persica] Length = 93 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_007162394.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] gi|561035858|gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] Length = 125 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 88 SVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 125 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 452 SVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 489 >emb|CBI32330.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 100 SVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 137 >ref|NP_001236540.1| uncharacterized protein LOC100305778 [Glycine max] gi|571445720|ref|XP_006576885.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Glycine max] gi|255626583|gb|ACU13636.1| unknown [Glycine max] Length = 93 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 93 >ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|355500846|gb|AES82049.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|388519597|gb|AFK47860.1| unknown [Lotus japonicus] Length = 93 Score = 79.0 bits (193), Expect = 7e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 56 SVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 93 >ref|XP_006384992.1| hypothetical protein POPTR_0004s22870g [Populus trichocarpa] gi|550341760|gb|ERP62789.1| hypothetical protein POPTR_0004s22870g [Populus trichocarpa] Length = 52 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 15 SVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 52 >gb|ABK93357.1| unknown [Populus trichocarpa] Length = 54 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -2 Query: 335 SVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 222 SVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 17 SVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 54