BLASTX nr result
ID: Sinomenium21_contig00015373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00015373 (892 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] 78 4e-12 ref|XP_006826141.1| hypothetical protein AMTR_s05716p00004100, p... 57 2e-06 >gb|AGC78985.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 198 Score = 78.2 bits (191), Expect = 4e-12 Identities = 42/59 (71%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -3 Query: 179 LYLDLSPKYGRTLT*RA*PTEG--SPPVPDIVLRRCPLGERGHHSLSFLNRSDQDKWVG 9 ++LDLSP Y R T G SPPVPDIVLRRCPLGERGHH LSF NRSDQDKWVG Sbjct: 17 IFLDLSP-YLRKNQHLKGVTNGRFSPPVPDIVLRRCPLGERGHHYLSFFNRSDQDKWVG 74 >ref|XP_006826141.1| hypothetical protein AMTR_s05716p00004100, partial [Amborella trichopoda] gi|548830281|gb|ERM93378.1| hypothetical protein AMTR_s05716p00004100, partial [Amborella trichopoda] Length = 67 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -1 Query: 154 MEEP*LKGRNQRKVLPLSPTLFSDDVPWAKGATILFLS 41 MEEP LKG NQ KVL LSPT FSDDVP KGAT LFLS Sbjct: 1 MEEPTLKGCNQSKVLTLSPTFFSDDVPREKGATNLFLS 38 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 24 GQVGWFVS 1 GQVGWFVS Sbjct: 43 GQVGWFVS 50