BLASTX nr result
ID: Sinomenium21_contig00014933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00014933 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACC77566.1| metallothionein [Prosopis juliflora] 61 2e-07 emb|CAA10232.1| metallothionein-like protein class II [Fagus syl... 59 7e-07 ref|XP_007134018.1| hypothetical protein PHAVU_010G012300g [Phas... 58 1e-06 dbj|BAD18374.1| type 1 metallothionein [Vigna radiata var. radiata] 58 1e-06 dbj|BAD18384.1| type 1 metallothionein [Lablab purpureus] 57 2e-06 gb|ABM21761.1| metallothionein-like protein MT2A [Salix matsudana] 57 2e-06 gb|ABD75757.1| metallothienein-like protein [Kandelia candel] 57 3e-06 gb|ABQ44281.1| metallothionein type 2 [Sesbania drummondii] 57 3e-06 ref|NP_001150795.1| metallothionein-like protein type 2 [Zea may... 57 3e-06 sp|Q39458.1|MT1_CICAR RecName: Full=Metallothionein-like protein... 56 5e-06 ref|XP_004506574.1| PREDICTED: metallothionein-like protein 1-li... 56 5e-06 ref|XP_004506573.1| PREDICTED: metallothionein-like protein 1-li... 56 5e-06 gb|AEK87151.1| metallothionein [Sesuvium portulacastrum] 56 5e-06 gb|ABF50984.1| metallothionein [Bruguiera gymnorhiza] 56 5e-06 gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] 56 5e-06 gb|AAB61212.1| metallothionein [Mesembryanthemum crystallinum] g... 56 6e-06 gb|ABA08415.1| type 2 metallothionein [Arachis hypogaea] gi|7447... 56 6e-06 gb|AAZ20290.1| type 2 metallothionein [Arachis hypogaea] gi|7447... 56 6e-06 dbj|BAD18378.1| type 1 metallothionein [Vigna angularis] 56 6e-06 gb|AFK13199.1| metallothionein type 2b-FL [Elaeis guineensis] 56 6e-06 >gb|ACC77566.1| metallothionein [Prosopis juliflora] Length = 73 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 368 EKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 E GAE +VAAENEGCKCGSNCTC+PCNC Sbjct: 45 ELEGAETVVAAENEGCKCGSNCTCNPCNC 73 >emb|CAA10232.1| metallothionein-like protein class II [Fagus sylvatica] Length = 79 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G P+ A+ +G +EM V AEN GCKCGSNCTCDPCNC Sbjct: 43 GVAPQKAHSEG-SEMGVGAENGGCKCGSNCTCDPCNC 78 >ref|XP_007134018.1| hypothetical protein PHAVU_010G012300g [Phaseolus vulgaris] gi|561007063|gb|ESW06012.1| hypothetical protein PHAVU_010G012300g [Phaseolus vulgaris] Length = 79 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -1 Query: 383 PEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 P + E G EM VAAEN GCKCGSNCTCDPC+C Sbjct: 45 PPLKAEMEGGEMGVAAENGGCKCGSNCTCDPCSC 78 >dbj|BAD18374.1| type 1 metallothionein [Vigna radiata var. radiata] Length = 73 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAE+ GCKCGSNCTCDPCNC Sbjct: 47 GAEMGVAAEDNGCKCGSNCTCDPCNC 72 >dbj|BAD18384.1| type 1 metallothionein [Lablab purpureus] Length = 73 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G P A +GG EM VAAE+ GCKCGSNCTCDPCNC Sbjct: 37 GVGPVKAQFEGG-EMGVAAEDSGCKCGSNCTCDPCNC 72 >gb|ABM21761.1| metallothionein-like protein MT2A [Salix matsudana] Length = 79 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G PE + +G AEM+V AEN GCKCG NCTCDPC C Sbjct: 43 GVAPEKNHFEGAAEMVVGAEN-GCKCGDNCTCDPCTC 78 >gb|ABD75757.1| metallothienein-like protein [Kandelia candel] Length = 79 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 377 VANEKG---GAEMIVAAENEGCKCGSNCTCDPCNC 282 VA E+G GAEM V AEN GCKCGSNCTCDPC C Sbjct: 44 VAPERGHLEGAEMGVPAENGGCKCGSNCTCDPCTC 78 >gb|ABQ44281.1| metallothionein type 2 [Sesbania drummondii] Length = 79 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAEN GCKCGSNC CDPCNC Sbjct: 53 GAEMGVAAENGGCKCGSNCPCDPCNC 78 >ref|NP_001150795.1| metallothionein-like protein type 2 [Zea mays] gi|195619866|gb|ACG31763.1| metallothionein-like protein type 2 [Zea mays] gi|195636910|gb|ACG37923.1| metallothionein-like protein type 2 [Zea mays] gi|195641920|gb|ACG40428.1| metallothionein-like protein type 2 [Zea mays] Length = 78 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -1 Query: 377 VANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 VA KGG E AEN GCKCG+NCTCDPC C Sbjct: 46 VAPSKGGVEAAAGAENGGCKCGANCTCDPCTC 77 >sp|Q39458.1|MT1_CICAR RecName: Full=Metallothionein-like protein 1; Short=MT-1 gi|1255702|emb|CAA65008.1| metallothionein [Cicer arietinum] Length = 75 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAE+ GCKCGS+CTCDPCNC Sbjct: 49 GAEMSVAAEDGGCKCGSSCTCDPCNC 74 >ref|XP_004506574.1| PREDICTED: metallothionein-like protein 1-like [Cicer arietinum] Length = 75 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAE+ GCKCGS+CTCDPCNC Sbjct: 49 GAEMSVAAEDGGCKCGSSCTCDPCNC 74 >ref|XP_004506573.1| PREDICTED: metallothionein-like protein 1-like [Cicer arietinum] Length = 76 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAE+ GCKCGS+CTCDPCNC Sbjct: 50 GAEMSVAAEDGGCKCGSSCTCDPCNC 75 >gb|AEK87151.1| metallothionein [Sesuvium portulacastrum] Length = 81 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G P+ + + G+EM V AEN GCKCGSNC CDPC C Sbjct: 44 GLAPKASYMESGSEMGVGAENGGCKCGSNCQCDPCTC 80 >gb|ABF50984.1| metallothionein [Bruguiera gymnorhiza] Length = 79 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G PE A+ +G AEM V AEN GCKCGSNCTCDPC C Sbjct: 43 GVGPERAHFEG-AEMGVPAENGGCKCGSNCTCDPCTC 78 >gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] Length = 80 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 G+EM AENEGCKCGSNCTC+PCNC Sbjct: 54 GSEMSFGAENEGCKCGSNCTCNPCNC 79 >gb|AAB61212.1| metallothionein [Mesembryanthemum crystallinum] gi|3342198|gb|AAC27531.1| metallothionein [Mesembryanthemum crystallinum] Length = 80 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = -1 Query: 392 GCTPEVANEKGGAEMIVAAENEGCKCGSNCTCDPCNC 282 G P+++ G+EM V AEN+GCKCGS+C CDPC C Sbjct: 43 GVAPKISYFDNGSEMGVGAENDGCKCGSDCKCDPCTC 79 >gb|ABA08415.1| type 2 metallothionein [Arachis hypogaea] gi|74476676|gb|ABA08416.1| type 2 metallothionein [Arachis hypogaea] gi|77955918|gb|ABB05520.1| type 2 metallothionein [Arachis hypogaea] Length = 80 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM V+AEN GCKCGSNCTCDPC C Sbjct: 54 GAEMGVSAENGGCKCGSNCTCDPCTC 79 >gb|AAZ20290.1| type 2 metallothionein [Arachis hypogaea] gi|74476672|gb|ABA08414.1| type 2 metallothionein [Arachis hypogaea] Length = 80 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM V+AEN GCKCGSNCTCDPC C Sbjct: 54 GAEMGVSAENGGCKCGSNCTCDPCTC 79 >dbj|BAD18378.1| type 1 metallothionein [Vigna angularis] Length = 73 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -1 Query: 359 GAEMIVAAENEGCKCGSNCTCDPCNC 282 GAEM VAAE+ GCKCGSNC CDPCNC Sbjct: 47 GAEMGVAAEDNGCKCGSNCPCDPCNC 72 >gb|AFK13199.1| metallothionein type 2b-FL [Elaeis guineensis] Length = 79 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = -1 Query: 377 VANEKG---GAEMIVAAENEGCKCGSNCTCDPCNC 282 VA +KG G EM +EN GCKCGSNCTCDPCNC Sbjct: 44 VAPQKGQVEGFEMATGSENGGCKCGSNCTCDPCNC 78