BLASTX nr result
ID: Sinomenium21_contig00014856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00014856 (696 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040541.1| Pentatricopeptide repeat superfamily protein... 64 5e-08 >ref|XP_007040541.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508777786|gb|EOY25042.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 661 Score = 63.9 bits (154), Expect = 5e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 695 IESEEIRISSCRTQHGYSGMGKGVEVPSSNEAEHSCCCSLCC 570 ++SEEIR SSCRTQHG S M KG ++ + EA+HSCCCSL C Sbjct: 255 VDSEEIRNSSCRTQHGDSSMEKGAKISADTEAKHSCCCSLYC 296