BLASTX nr result
ID: Sinomenium21_contig00014769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00014769 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310770.2| hypothetical protein POPTR_0007s11980g [Popu... 56 6e-06 >ref|XP_002310770.2| hypothetical protein POPTR_0007s11980g [Populus trichocarpa] gi|550334702|gb|EEE91220.2| hypothetical protein POPTR_0007s11980g [Populus trichocarpa] Length = 184 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 438 FLKKRKMQVPRSSSVLNHPNQALRLISSRGLLNKK 334 FLKK+KMQ+ RSSSVLN+PNQALRLIS+ GL +KK Sbjct: 150 FLKKKKMQLSRSSSVLNNPNQALRLISTSGLFSKK 184