BLASTX nr result
ID: Sinomenium21_contig00014664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00014664 (743 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007157301.1| hypothetical protein PHAVU_002G058500g [Phas... 70 6e-10 gb|EXC18345.1| hypothetical protein L484_005698 [Morus notabilis] 67 9e-09 gb|EXC07109.1| hypothetical protein L484_001609 [Morus notabilis] 67 9e-09 ref|XP_003537787.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfam... 63 9e-08 ref|XP_003609027.1| Pentatricopeptide repeat-containing protein ... 60 6e-07 ref|XP_004505735.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-06 >ref|XP_007157301.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|593788526|ref|XP_007157302.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|593788528|ref|XP_007157303.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030716|gb|ESW29295.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030717|gb|ESW29296.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] gi|561030718|gb|ESW29297.1| hypothetical protein PHAVU_002G058500g [Phaseolus vulgaris] Length = 583 Score = 70.5 bits (171), Expect = 6e-10 Identities = 33/69 (47%), Positives = 49/69 (71%) Frame = -1 Query: 506 LNRSRISELISKQHWRDLRSIVGQISPEKFMQNLFESEEIDAEIILRYLRWSEKEFKISY 327 L+ S ISEL+SKQHW +LR + P F+ LF +E +D+E++LR+ +WS+KEF+ISY Sbjct: 18 LSISTISELLSKQHWSELRPLFRTTKPAIFIDQLFNAE-VDSELVLRFFQWSQKEFRISY 76 Query: 326 GLNLPWEML 300 GL ++L Sbjct: 77 GLETTAKVL 85 >gb|EXC18345.1| hypothetical protein L484_005698 [Morus notabilis] Length = 594 Score = 66.6 bits (161), Expect = 9e-09 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Frame = -1 Query: 557 DSQERRLFSCLDSSEERLNRSRISELISKQHWRDL-RSIVGQISPEKFMQNLFESEEIDA 381 + Q R C S N +SELI+KQHW +L R+ + +P K +Q LFESE +D Sbjct: 16 NKQSRSRLLCTASISHTFNAPLVSELIAKQHWSELKRTHLTDSNPTKLLQQLFESE-VDP 74 Query: 380 EIILRYLRWSEKEFKISYGLNLPWEML 300 ++I RY WS KE IS+ L L +L Sbjct: 75 DLIFRYFNWSHKELNISHTLELTCRLL 101 >gb|EXC07109.1| hypothetical protein L484_001609 [Morus notabilis] Length = 595 Score = 66.6 bits (161), Expect = 9e-09 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Frame = -1 Query: 557 DSQERRLFSCLDSSEERLNRSRISELISKQHWRDL-RSIVGQISPEKFMQNLFESEEIDA 381 + Q R C S N +SELI+KQHW +L R+ + +P K +Q LFESE +D Sbjct: 17 NKQSRSRLLCTASISHTFNAPLVSELIAKQHWSELKRTHLTDSNPTKLLQQLFESE-VDP 75 Query: 380 EIILRYLRWSEKEFKISYGLNLPWEML 300 ++I RY WS KE IS+ L L +L Sbjct: 76 DLIFRYFNWSHKELNISHTLELTCRLL 102 >ref|XP_003537787.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Glycine max] Length = 583 Score = 63.9 bits (154), Expect = 6e-08 Identities = 30/71 (42%), Positives = 47/71 (66%) Frame = -1 Query: 512 ERLNRSRISELISKQHWRDLRSIVGQISPEKFMQNLFESEEIDAEIILRYLRWSEKEFKI 333 + L+ S ISEL+S QHW +L+ P F+ LF + +D+E++LR+ +WS+KEF+I Sbjct: 16 QSLSISTISELLSNQHWSELKPHFRTTKPAIFLDQLFNAG-VDSELVLRFFQWSQKEFRI 74 Query: 332 SYGLNLPWEML 300 SYGL ++L Sbjct: 75 SYGLETTGKVL 85 >ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508719753|gb|EOY11650.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 587 Score = 63.2 bits (152), Expect = 9e-08 Identities = 30/73 (41%), Positives = 46/73 (63%) Frame = -1 Query: 518 SEERLNRSRISELISKQHWRDLRSIVGQISPEKFMQNLFESEEIDAEIILRYLRWSEKEF 339 S + + I+EL+SKQ W L+S + +SP +Q L +S+ D ++ LRY RWSEKEF Sbjct: 51 SSDNIPSPSITELLSKQRWNKLKSHLQNVSPSTLLQQLLDSKT-DPDLTLRYFRWSEKEF 109 Query: 338 KISYGLNLPWEML 300 +S+ L L ++L Sbjct: 110 NLSHSLELSCKLL 122 >ref|XP_003609027.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510082|gb|AES91224.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 583 Score = 60.5 bits (145), Expect = 6e-07 Identities = 26/64 (40%), Positives = 44/64 (68%) Frame = -1 Query: 512 ERLNRSRISELISKQHWRDLRSIVGQISPEKFMQNLFESEEIDAEIILRYLRWSEKEFKI 333 + L+ ISEL+SKQHW +L+ + P F+ L + +D+E++LR+ +WS+KE+++ Sbjct: 16 QSLSIPTISELLSKQHWSELKPHLRVTKPATFLDQLLNAG-VDSELVLRFFKWSQKEYRL 74 Query: 332 SYGL 321 SYGL Sbjct: 75 SYGL 78 >ref|XP_004505735.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like [Cicer arietinum] Length = 586 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/66 (39%), Positives = 44/66 (66%) Frame = -1 Query: 497 SRISELISKQHWRDLRSIVGQISPEKFMQNLFESEEIDAEIILRYLRWSEKEFKISYGLN 318 S+ISEL+ KQHW +L+ + P F+ L + +D+E++LR+ +WS+KEF++SY L Sbjct: 24 SKISELLGKQHWSELKPHLRVTKPATFLDQLLNAG-VDSELVLRFFKWSQKEFRLSYDLE 82 Query: 317 LPWEML 300 ++L Sbjct: 83 ATAKVL 88