BLASTX nr result
ID: Sinomenium21_contig00014573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00014573 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_002527500.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibi... 63 4e-08 ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phas... 61 1e-07 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 ref|XP_007133577.1| hypothetical protein PHAVU_011G190800g [Phas... 59 7e-07 ref|XP_007133040.1| hypothetical protein PHAVU_011G146300g, part... 58 1e-06 ref|XP_007131815.1| hypothetical protein PHAVU_011G043800g, part... 57 3e-06 ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Popu... 55 1e-05 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 55 1e-05 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/55 (65%), Positives = 38/55 (69%) Frame = -3 Query: 193 WLARSKSRVEPCCSSEGWGDTSPRVEGTA*GWLHRAATTSCSRQWKDYEPVLFGS 29 WLARSK RV+PC EG G PR EGTA GW HRAA TS S QWKD PVL G+ Sbjct: 3 WLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLPGA 57 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = -1 Query: 192 GSPVPSRELNRVAPAKAGATRVLEWRAPREAGFTEQRLPPVLDSGRITSRC 40 G P PS EL+ V AK G T +LEWR REAGFTEQR PP LDSG IT C Sbjct: 10 GLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSC 60 >ref|XP_002527500.1| conserved hypothetical protein [Ricinus communis] gi|223533140|gb|EEF34898.1| conserved hypothetical protein [Ricinus communis] Length = 61 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 192 GSPVPSRELNRVAPAKAGATRVLEWRAPREAGFTEQRLPPVLD 64 GSPVPS ELNRVA AKA A+ LEWR PREAGFTE++ PP L+ Sbjct: 10 GSPVPSWELNRVARAKAWASLFLEWREPREAGFTEEQKPPSLE 52 >ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] gi|508714675|gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] Length = 686 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 41 HRLVILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEPVKELYEPNQ 220 H LVILPL T RCSVKPASRGAL SR + A A+A FN +LGTG+P ++ P Q Sbjct: 2 HWLVILPLFVTESFRCSVKPASRGALLSRNQEAQAYARTPWFNYQLGTGKPESRIHGPYQ 61 >ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] gi|561006039|gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] Length = 93 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = +2 Query: 50 VILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEPVKELYEPNQ 220 VILPL GG RCSVKPASR ALHS+++ AF R NS+LG G P + P Q Sbjct: 5 VILPLLGMGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRPTNCKHSPTQ 61 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/75 (46%), Positives = 42/75 (56%) Frame = +2 Query: 29 GPEQHRLVILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEPVKELY 208 G +H+LVILPL R GG RCSVKPASR AL SR +V PAFA G + + Sbjct: 13 GLGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPH 72 Query: 209 EPNQSRPNQCSATLM 253 + + P Q TLM Sbjct: 73 QGRPTGPEQRPITLM 87 >ref|XP_007133577.1| hypothetical protein PHAVU_011G190800g [Phaseolus vulgaris] gi|561006577|gb|ESW05571.1| hypothetical protein PHAVU_011G190800g [Phaseolus vulgaris] Length = 67 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/61 (50%), Positives = 36/61 (59%) Frame = +2 Query: 50 VILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEPVKELYEPNQSRP 229 VI PL GG RCSVKPASR ALHS+++ AF R NS+LG G P + P Q Sbjct: 3 VIPPLLGVGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRPTYCKHSPTQQAL 62 Query: 230 N 232 N Sbjct: 63 N 63 >ref|XP_007133040.1| hypothetical protein PHAVU_011G146300g, partial [Phaseolus vulgaris] gi|561006040|gb|ESW05034.1| hypothetical protein PHAVU_011G146300g, partial [Phaseolus vulgaris] Length = 57 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +2 Query: 50 VILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEP 193 VILPL GG RCSVKPASR ALHS+++ AF R NS+LG G P Sbjct: 5 VILPLLGMGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRP 52 >ref|XP_007131815.1| hypothetical protein PHAVU_011G043800g, partial [Phaseolus vulgaris] gi|561004815|gb|ESW03809.1| hypothetical protein PHAVU_011G043800g, partial [Phaseolus vulgaris] Length = 70 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/68 (51%), Positives = 39/68 (57%) Frame = +2 Query: 35 EQHRLVILPLSRTGGSRCSVKPASRGALHSRTRVAPAFAGATRFNSRLGTGEPVKELYEP 214 E + VI PLSR GSRCSVKPASR AL SR + AFA NS+LG G+P Sbjct: 8 EMQQPVIPPLSRARGSRCSVKPASRIALSSRNQETNAFAMFPWLNSQLGVGKPADA---- 63 Query: 215 NQSRPNQC 238 SRP C Sbjct: 64 -TSRPTWC 70 >ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] gi|550318586|gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] Length = 83 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/58 (51%), Positives = 36/58 (62%) Frame = -1 Query: 213 GSYSSFTGSPVPSRELNRVAPAKAGATRVLEWRAPREAGFTEQRLPPVLDSGRITSRC 40 GS + PVPS+EL++ K + +LE RA REAG TEQR PP SGRIT RC Sbjct: 6 GSGCLLSDPPVPSQELSQGILVKTLVSWLLEGRAQREAGLTEQRSPPAPGSGRITGRC 63 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/62 (50%), Positives = 37/62 (59%) Frame = -1 Query: 213 GSYSSFTGSPVPSRELNRVAPAKAGATRVLEWRAPREAGFTEQRLPPVLDSGRITSRCCS 34 GS +G PVPS+EL++ K + +LE RA REAG TEQR P SGRIT RC Sbjct: 6 GSGCFLSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGRCHL 65 Query: 33 GP 28 P Sbjct: 66 DP 67