BLASTX nr result
ID: Sinomenium21_contig00013807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00013807 (522 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016137.1| Anthranilate synthase component I-2 isoform ... 70 3e-10 ref|XP_007016135.1| Anthranilate synthase component I-2 isoform ... 70 3e-10 ref|XP_007016134.1| Anthranilate synthase component I-2 isoform ... 70 3e-10 ref|XP_007016133.1| Anthranilate synthase component I-2 isoform ... 70 3e-10 ref|XP_007016132.1| Anthranilate synthase 2 isoform 1 [Theobroma... 70 3e-10 gb|AAA74900.1| anthranilate synthase alpha subunit [Ruta graveol... 62 1e-07 ref|XP_004295746.1| PREDICTED: anthranilate synthase component I... 61 1e-07 ref|XP_006488497.1| PREDICTED: anthranilate synthase component I... 61 2e-07 ref|XP_006425048.1| hypothetical protein CICLE_v10028065mg [Citr... 60 2e-07 ref|XP_002525623.1| anthranilate synthase component I, putative ... 58 2e-06 ref|XP_006344046.1| PREDICTED: anthranilate synthase component I... 56 5e-06 gb|EXC01464.1| Anthranilate synthase component I-2 [Morus notabi... 55 8e-06 gb|EXB62189.1| Anthranilate synthase component I-2 [Morus notabi... 55 8e-06 >ref|XP_007016137.1| Anthranilate synthase component I-2 isoform 6 [Theobroma cacao] gi|508786500|gb|EOY33756.1| Anthranilate synthase component I-2 isoform 6 [Theobroma cacao] Length = 515 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVST-SSLVEDAVNFA 58 S LCPST +S +G+ RSR S+ + S R R+LKCSA+S+ SSLV+ +V F Sbjct: 18 STPLCPSTT-VSVNFNARLSGY-RSR-SLLLLSSTSRIRTLKCSALSSPSSLVDQSVKFR 74 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASKNGNL+P+FRCIF DH Sbjct: 75 EASKNGNLVPLFRCIFSDH 93 >ref|XP_007016135.1| Anthranilate synthase component I-2 isoform 4 [Theobroma cacao] gi|508786498|gb|EOY33754.1| Anthranilate synthase component I-2 isoform 4 [Theobroma cacao] Length = 506 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVST-SSLVEDAVNFA 58 S LCPST +S +G+ RSR S+ + S R R+LKCSA+S+ SSLV+ +V F Sbjct: 18 STPLCPSTT-VSVNFNARLSGY-RSR-SLLLLSSTSRIRTLKCSALSSPSSLVDQSVKFR 74 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASKNGNL+P+FRCIF DH Sbjct: 75 EASKNGNLVPLFRCIFSDH 93 >ref|XP_007016134.1| Anthranilate synthase component I-2 isoform 3 [Theobroma cacao] gi|508786497|gb|EOY33753.1| Anthranilate synthase component I-2 isoform 3 [Theobroma cacao] Length = 465 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVST-SSLVEDAVNFA 58 S LCPST +S +G+ RSR S+ + S R R+LKCSA+S+ SSLV+ +V F Sbjct: 18 STPLCPSTT-VSVNFNARLSGY-RSR-SLLLLSSTSRIRTLKCSALSSPSSLVDQSVKFR 74 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASKNGNL+P+FRCIF DH Sbjct: 75 EASKNGNLVPLFRCIFSDH 93 >ref|XP_007016133.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] gi|590588152|ref|XP_007016136.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] gi|508786496|gb|EOY33752.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] gi|508786499|gb|EOY33755.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao] Length = 471 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVST-SSLVEDAVNFA 58 S LCPST +S +G+ RSR S+ + S R R+LKCSA+S+ SSLV+ +V F Sbjct: 18 STPLCPSTT-VSVNFNARLSGY-RSR-SLLLLSSTSRIRTLKCSALSSPSSLVDQSVKFR 74 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASKNGNL+P+FRCIF DH Sbjct: 75 EASKNGNLVPLFRCIFSDH 93 >ref|XP_007016132.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao] gi|508786495|gb|EOY33751.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao] Length = 596 Score = 70.1 bits (170), Expect = 3e-10 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVST-SSLVEDAVNFA 58 S LCPST +S +G+ RSR S+ + S R R+LKCSA+S+ SSLV+ +V F Sbjct: 18 STPLCPSTT-VSVNFNARLSGY-RSR-SLLLLSSTSRIRTLKCSALSSPSSLVDQSVKFR 74 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASKNGNL+P+FRCIF DH Sbjct: 75 EASKNGNLVPLFRCIFSDH 93 >gb|AAA74900.1| anthranilate synthase alpha subunit [Ruta graveolens] Length = 608 Score = 61.6 bits (148), Expect = 1e-07 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 16/89 (17%) Frame = -1 Query: 219 PSTVRLSPAIYCN---RTGFGRSR-NSVSFVGSRCRHRSLKCSA-----VSTS------- 88 PST R+S A N R R R NS+S S R R+LKC+A STS Sbjct: 17 PSTFRVSSAASVNFNDRVATSRWRPNSLSLTTSSYRLRTLKCAASASTSASTSASPSPSP 76 Query: 87 SLVEDAVNFAEASKNGNLLPIFRCIFCDH 1 SLV+ + NF EASK GNL+P++RCIF DH Sbjct: 77 SLVDQSANFHEASKKGNLIPLYRCIFSDH 105 >ref|XP_004295746.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 585 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = -1 Query: 168 GRSRNSVSFVGSRCRHRSLKCSAVSTSSLVEDAVNFAEASKNGNLLPIFRCIFCDH 1 GR +S+ + S R R+L+CSA+S+ SL E + F EASKNGNL+P++R +F DH Sbjct: 27 GRFSSSLPLLRSTARVRTLRCSALSSPSLAEQSEKFFEASKNGNLIPLYRSVFSDH 82 >ref|XP_006488497.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Citrus sinensis] Length = 596 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/82 (41%), Positives = 48/82 (58%), Gaps = 4/82 (4%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCN---RTGFGRSRN-SVSFVGSRCRHRSLKCSAVSTSSLVEDAV 67 +P PSTV S + N R + R+ S+SF S R R+L C+A ++ V+ + Sbjct: 12 TPSQLPSTVGFSSTVSVNFNDRVASSKWRSKSLSFTSSSYRARTLTCAASASLLFVDQSE 71 Query: 66 NFAEASKNGNLLPIFRCIFCDH 1 F EASK GNL+P++RCIF DH Sbjct: 72 KFQEASKKGNLIPLYRCIFSDH 93 >ref|XP_006425048.1| hypothetical protein CICLE_v10028065mg [Citrus clementina] gi|557526982|gb|ESR38288.1| hypothetical protein CICLE_v10028065mg [Citrus clementina] Length = 596 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 4/82 (4%) Frame = -1 Query: 234 SPRLCPSTVRLSPAIYCN---RTGFGRSR-NSVSFVGSRCRHRSLKCSAVSTSSLVEDAV 67 +P PSTV S + N R + R S+SF S R R+L C+A ++ V+ Sbjct: 12 TPSQLPSTVGFSSTVSVNFNYRVASSKWRPKSLSFTSSSYRARTLTCAASASLLFVDQLA 71 Query: 66 NFAEASKNGNLLPIFRCIFCDH 1 F EASK GNL+P++RCIF DH Sbjct: 72 KFQEASKTGNLIPLYRCIFSDH 93 >ref|XP_002525623.1| anthranilate synthase component I, putative [Ricinus communis] gi|223535059|gb|EEF36741.1| anthranilate synthase component I, putative [Ricinus communis] Length = 614 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = -1 Query: 228 RLCPSTVRLSPAIYCNRTG-FGRS--RNSVSFVGSRCRHRSLKCSAVSTSSLVEDAVNFA 58 R P TV L P+ N F S + S+S V S R +LKCSA ++ + + + F Sbjct: 33 RQLPLTVPLPPSSSVNPNARFCTSILKKSLSLVSSSPRVPTLKCSASTSQAYADQSAKFQ 92 Query: 57 EASKNGNLLPIFRCIFCDH 1 EASK GNL+P++ CI CDH Sbjct: 93 EASKKGNLVPLYHCILCDH 111 >ref|XP_006344046.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like [Solanum tuberosum] Length = 587 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = -1 Query: 168 GRSRNSVSFVGS---RCRHRSLKCSA-VSTSSLVEDAVNFAEASKNGNLLPIFRCIFCDH 1 G S+SF S R R LKCSA VS SLV+D+V F EA+K+GNL+P++R IF DH Sbjct: 25 GHRATSLSFSSSPVAAARLRILKCSAAVSPPSLVDDSVKFKEAAKDGNLIPLYRSIFSDH 84 >gb|EXC01464.1| Anthranilate synthase component I-2 [Morus notabilis] Length = 738 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -1 Query: 216 STVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVSTSSLVEDAVNFAEASKNGN 37 ST+RL + + G R +S+ R + +CSA+S+ SLV+ + F+EASK GN Sbjct: 10 STLRLPSMVSVSFNG--RLSSSIVLTKPSSRVHTFRCSALSSPSLVDQSERFSEASKKGN 67 Query: 36 LLPIFRCIFCDH 1 L+P++R IF DH Sbjct: 68 LIPLYRTIFSDH 79 >gb|EXB62189.1| Anthranilate synthase component I-2 [Morus notabilis] Length = 288 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = -1 Query: 216 STVRLSPAIYCNRTGFGRSRNSVSFVGSRCRHRSLKCSAVSTSSLVEDAVNFAEASKNGN 37 ST+RL + + G R +S+ R + +CSA+S+ SLV+ + F+EASK GN Sbjct: 10 STLRLPSMVSVSFNG--RLSSSIVLTKPSSRVHTFRCSALSSPSLVDQSERFSEASKKGN 67 Query: 36 LLPIFRCIFCDH 1 L+P++R IF DH Sbjct: 68 LIPLYRTIFSDH 79