BLASTX nr result
ID: Sinomenium21_contig00013580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00013580 (739 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855359.1| hypothetical protein AMTR_s00057p00113710 [A... 59 1e-06 >ref|XP_006855359.1| hypothetical protein AMTR_s00057p00113710 [Amborella trichopoda] gi|548859125|gb|ERN16826.1| hypothetical protein AMTR_s00057p00113710 [Amborella trichopoda] Length = 133 Score = 59.3 bits (142), Expect = 1e-06 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 1/78 (1%) Frame = +3 Query: 225 KFRILRPKKLLSRLRDAYRKLMLRLFNG-GVVNVVNEATCNYNDRFDDDGKPVVVAKEYE 401 KF+I PKKLL RLRDAY K ML L N N + +Y F +P V KEY+ Sbjct: 48 KFKIPNPKKLLIRLRDAYVKAMLSLANSRAFTGGGNFSGMSYGQPF---ARPPV--KEYD 102 Query: 402 KKILCQIYRTLMVQGQLV 455 +K+L +IYR+LM QGQ+V Sbjct: 103 EKMLVEIYRSLMAQGQIV 120