BLASTX nr result
ID: Sinomenium21_contig00013368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00013368 (581 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001142327.1| hypothetical protein [Zea mays] gi|194690954... 58 2e-06 ref|XP_002463333.1| hypothetical protein SORBIDRAFT_02g041960 [S... 57 4e-06 ref|XP_004958590.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl... 57 5e-06 >ref|NP_001142327.1| hypothetical protein [Zea mays] gi|194690954|gb|ACF79561.1| unknown [Zea mays] gi|194708226|gb|ACF88197.1| unknown [Zea mays] gi|414591098|tpg|DAA41669.1| TPA: hypothetical protein ZEAMMB73_004711 [Zea mays] Length = 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/60 (50%), Positives = 34/60 (56%) Frame = -1 Query: 437 RFDPEXXXXXXXXXXXLVNIFLRLFGRCSEKSLCIKXXXXXXXXXXXXXXLRYLLAGWYK 258 RFDPE LVNIFLRLFG+CSEK+LCI+ LRY+L GWYK Sbjct: 363 RFDPETGLLTGTKDGNLVNIFLRLFGKCSEKALCIRLLIFQALCCVFCFWLRYMLTGWYK 422 >ref|XP_002463333.1| hypothetical protein SORBIDRAFT_02g041960 [Sorghum bicolor] gi|241926710|gb|EER99854.1| hypothetical protein SORBIDRAFT_02g041960 [Sorghum bicolor] Length = 421 Score = 57.0 bits (136), Expect = 4e-06 Identities = 30/60 (50%), Positives = 33/60 (55%) Frame = -1 Query: 437 RFDPEXXXXXXXXXXXLVNIFLRLFGRCSEKSLCIKXXXXXXXXXXXXXXLRYLLAGWYK 258 RFDPE LVNIFLRLFG+CSEK LCI+ LRY+L GWYK Sbjct: 362 RFDPETGLLTGTKDGNLVNIFLRLFGKCSEKVLCIRLLIFQALCCVFCFWLRYMLTGWYK 421 >ref|XP_004958590.1| PREDICTED: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like [Setaria italica] Length = 424 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/60 (48%), Positives = 34/60 (56%) Frame = -1 Query: 437 RFDPEXXXXXXXXXXXLVNIFLRLFGRCSEKSLCIKXXXXXXXXXXXXXXLRYLLAGWYK 258 RFDP+ LVNIFLRLFG+CSEK+LCI+ LRY+L GWYK Sbjct: 365 RFDPQTGLLTGTKDGNLVNIFLRLFGKCSEKALCIRLLIFQALCCVFCFWLRYVLTGWYK 424