BLASTX nr result
ID: Sinomenium21_contig00013326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00013326 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368259.1| Cell division control protein 48 B [Populus ... 58 1e-06 ref|XP_004239044.1| PREDICTED: cell division control protein 48 ... 58 2e-06 ref|XP_006348680.1| PREDICTED: cell division control protein 48 ... 57 4e-06 gb|ABK24770.1| unknown [Picea sitchensis] 56 6e-06 >ref|XP_006368259.1| Cell division control protein 48 B [Populus trichocarpa] gi|550346162|gb|ERP64828.1| Cell division control protein 48 B [Populus trichocarpa] Length = 571 Score = 58.2 bits (139), Expect = 1e-06 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = +2 Query: 2 DPSVNVRALAASCNGYVGLI*KLCVGKVQCLQCGDLQM*QKMPVYAANSG*LEACEV-GP 178 DP+VN+ A+AASCNGYVG + + L + V A V GP Sbjct: 234 DPNVNLHAIAASCNGYVGADLEALCREATMSALNSLDTSEDAGVQLTMDDWKHAKSVVGP 293 Query: 179 SITRGVTVEIPKVSWE 226 SITRGVT+EIPKVSWE Sbjct: 294 SITRGVTMEIPKVSWE 309 >ref|XP_004239044.1| PREDICTED: cell division control protein 48 homolog B-like [Solanum lycopersicum] Length = 611 Score = 57.8 bits (138), Expect = 2e-06 Identities = 37/78 (47%), Positives = 43/78 (55%), Gaps = 3/78 (3%) Frame = +2 Query: 2 DPSVNVRALAASCNGYVGL-I*KLC--VGKVQCLQCGDLQM*QKMPVYAANSG*LEACEV 172 D SV++RA+AASCNGYVG + LC +C D + V Sbjct: 212 DASVDLRAVAASCNGYVGADLEALCREAAMSAVRKCSDSNLDDDSYSINMEDWKHARSVV 271 Query: 173 GPSITRGVTVEIPKVSWE 226 GPSITRGVTVEIPKVSWE Sbjct: 272 GPSITRGVTVEIPKVSWE 289 >ref|XP_006348680.1| PREDICTED: cell division control protein 48 homolog B-like [Solanum tuberosum] Length = 611 Score = 56.6 bits (135), Expect = 4e-06 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +2 Query: 2 DPSVNVRALAASCNGYVGL-I*KLC--VGKVQCLQCGDLQM*QKMPVYAANSG*LEACEV 172 D SV++RA+A SCNGYVG + LC +C D + V Sbjct: 212 DASVDLRAVAVSCNGYVGADLEALCREAAMSAVRKCSDSNLEDSSYSINMEDWKHARSVV 271 Query: 173 GPSITRGVTVEIPKVSWE 226 GPSITRGVTVEIPKVSWE Sbjct: 272 GPSITRGVTVEIPKVSWE 289 >gb|ABK24770.1| unknown [Picea sitchensis] Length = 416 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 2/77 (2%) Frame = +2 Query: 2 DPSVNVRALAASCNGYVGL-I*KLC-VGKVQCLQCGDLQM*QKMPVYAANSG*LEACEVG 175 D SVN+ A+AASCNGYVG + LC + ++ + ++ P + +VG Sbjct: 64 DQSVNLYAVAASCNGYVGADLAALCREAAMSTIRKSSVDWEEEFPSITMEDWEVARSKVG 123 Query: 176 PSITRGVTVEIPKVSWE 226 PSI RGV E+PKVSWE Sbjct: 124 PSIVRGVIAEVPKVSWE 140