BLASTX nr result
ID: Sinomenium21_contig00012942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00012942 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211566.1| hypothetical protein PRUPE_ppa008327mg [Prun... 61 1e-07 ref|XP_006449008.1| hypothetical protein CICLE_v10015828mg [Citr... 58 1e-06 ref|XP_006449007.1| hypothetical protein CICLE_v10015828mg [Citr... 58 1e-06 ref|XP_006449005.1| hypothetical protein CICLE_v10015828mg [Citr... 58 1e-06 ref|XP_004293562.1| PREDICTED: putative ALA-interacting subunit ... 57 3e-06 >ref|XP_007211566.1| hypothetical protein PRUPE_ppa008327mg [Prunus persica] gi|462407431|gb|EMJ12765.1| hypothetical protein PRUPE_ppa008327mg [Prunus persica] Length = 336 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 240 QSVPVLSRRKKVLYQFTQQSLPACKPVLTPAWV 338 QS+P+ SRR++ YQFTQQSLPACKPVLTPAWV Sbjct: 15 QSIPLQSRRQRAFYQFTQQSLPACKPVLTPAWV 47 >ref|XP_006449008.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] gi|557551619|gb|ESR62248.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] Length = 341 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 240 QSVPVLSRRKKVLYQFTQQSLPACKPVLTPAWV 338 + +P+ SRR KV YQFTQQ+LPACKPVLTP+W+ Sbjct: 16 RKIPIQSRRAKVFYQFTQQNLPACKPVLTPSWI 48 >ref|XP_006449007.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] gi|557551618|gb|ESR62247.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] Length = 331 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 240 QSVPVLSRRKKVLYQFTQQSLPACKPVLTPAWV 338 + +P+ SRR KV YQFTQQ+LPACKPVLTP+W+ Sbjct: 16 RKIPIQSRRAKVFYQFTQQNLPACKPVLTPSWI 48 >ref|XP_006449005.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] gi|557551616|gb|ESR62245.1| hypothetical protein CICLE_v10015828mg [Citrus clementina] Length = 343 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 240 QSVPVLSRRKKVLYQFTQQSLPACKPVLTPAWV 338 + +P+ SRR KV YQFTQQ+LPACKPVLTP+W+ Sbjct: 16 RKIPIQSRRAKVFYQFTQQNLPACKPVLTPSWI 48 >ref|XP_004293562.1| PREDICTED: putative ALA-interacting subunit 2-like [Fragaria vesca subsp. vesca] Length = 334 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 240 QSVPVLSRRKKVLYQFTQQSLPACKPVLTPAWV 338 QSVP SR+ K YQFTQQSLPACKP+LTP WV Sbjct: 17 QSVPRHSRKHKAFYQFTQQSLPACKPILTPPWV 49