BLASTX nr result
ID: Sinomenium21_contig00011934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00011934 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039579.1| CheY-like two-component responsive regulator... 56 5e-06 ref|XP_007039578.1| CheY-like two-component responsive regulator... 56 5e-06 ref|XP_004965430.1| PREDICTED: probable transcription factor GLK... 56 6e-06 ref|XP_006358579.1| PREDICTED: two-component response regulator-... 55 8e-06 ref|XP_006847667.1| hypothetical protein AMTR_s00149p00035260 [A... 55 8e-06 ref|XP_006283488.1| hypothetical protein CARUB_v10004540mg [Caps... 55 8e-06 gb|AGF37241.1| APRR2-like protein, partial [Capsicum annuum] 55 8e-06 ref|NP_001266246.1| two-component response regulator-like APRR2-... 55 8e-06 >ref|XP_007039579.1| CheY-like two-component responsive regulator family protein isoform 2 [Theobroma cacao] gi|508776824|gb|EOY24080.1| CheY-like two-component responsive regulator family protein isoform 2 [Theobroma cacao] Length = 510 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAVDQLG+DQAIPS Sbjct: 319 KVDWTPELHKQFVQAVDQLGVDQAIPS 345 >ref|XP_007039578.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|590675897|ref|XP_007039580.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|508776823|gb|EOY24079.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] gi|508776825|gb|EOY24081.1| CheY-like two-component responsive regulator family protein isoform 1 [Theobroma cacao] Length = 556 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAVDQLG+DQAIPS Sbjct: 319 KVDWTPELHKQFVQAVDQLGVDQAIPS 345 >ref|XP_004965430.1| PREDICTED: probable transcription factor GLK1-like isoform X1 [Setaria italica] Length = 486 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = -2 Query: 173 QVTSQLADSPNYS*K*KFCNFYMVFLFFTYQVDWTPELHKRFVQAVDQLGIDQAIPS 3 +V L SPN + + + + + F ++VDWTPELH+RFVQAV+QLGID+A+PS Sbjct: 181 RVHVNLQASPNRNQTLRMSHVTLRYAIF-FKVDWTPELHRRFVQAVEQLGIDKAVPS 236 >ref|XP_006358579.1| PREDICTED: two-component response regulator-like APRR2-like [Solanum tuberosum] Length = 560 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAV+QLGIDQAIPS Sbjct: 318 KVDWTPELHKKFVQAVEQLGIDQAIPS 344 >ref|XP_006847667.1| hypothetical protein AMTR_s00149p00035260 [Amborella trichopoda] gi|548850936|gb|ERN09248.1| hypothetical protein AMTR_s00149p00035260 [Amborella trichopoda] Length = 575 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELH+RFVQAV+QLGIDQAIPS Sbjct: 337 KVDWTPELHRRFVQAVEQLGIDQAIPS 363 >ref|XP_006283488.1| hypothetical protein CARUB_v10004540mg [Capsella rubella] gi|482552193|gb|EOA16386.1| hypothetical protein CARUB_v10004540mg [Capsella rubella] Length = 540 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAV+QLGIDQAIPS Sbjct: 298 KVDWTPELHKKFVQAVEQLGIDQAIPS 324 >gb|AGF37241.1| APRR2-like protein, partial [Capsicum annuum] Length = 505 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAV+QLGIDQAIPS Sbjct: 318 KVDWTPELHKKFVQAVEQLGIDQAIPS 344 >ref|NP_001266246.1| two-component response regulator-like APRR2-like [Solanum lycopersicum] gi|419193836|gb|AFX68729.1| APRR2-like protein [Solanum lycopersicum] Length = 560 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 83 QVDWTPELHKRFVQAVDQLGIDQAIPS 3 +VDWTPELHK+FVQAV+QLGIDQAIPS Sbjct: 318 KVDWTPELHKKFVQAVEQLGIDQAIPS 344