BLASTX nr result
ID: Sinomenium21_contig00011644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00011644 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P35477.1|PLAS2_TOBAC RecName: Full=Plastocyanin B'/B'' gi|544... 86 4e-15 gb|EXB81496.1| Plastocyanin [Morus notabilis] 84 2e-14 sp|P35476.1|PLAS1_TOBAC RecName: Full=Plastocyanin A'/A'' gi|544... 83 4e-14 ref|WP_017428787.1| hypothetical protein, partial [Vibrio vulnif... 83 4e-14 ref|XP_002510603.1| Plastocyanin A, chloroplast precursor, putat... 82 6e-14 sp|P00297.1|PLAS_SOLCR RecName: Full=Plastocyanin gi|223147|prf|... 82 8e-14 gb|ABG81099.1| b-plastocyanin [Pelargonium x hortorum] 82 1e-13 ref|XP_006435266.1| hypothetical protein CICLE_v10002698mg [Citr... 81 1e-13 ref|XP_004291323.1| PREDICTED: plastocyanin, chloroplastic-like ... 81 2e-13 ref|XP_004238398.1| PREDICTED: plastocyanin, chloroplastic [Sola... 81 2e-13 ref|XP_002285904.1| PREDICTED: plastocyanin, chloroplastic isofo... 80 2e-13 emb|CAN64704.1| hypothetical protein VITISV_038998 [Vitis vinifera] 80 2e-13 gb|AAR85968.1| ERT10 [Nicotiana tabacum] 80 2e-13 pdb|1AG6|A Chain A, Plastocyanin From Spinach 80 3e-13 pdb|1OOW|A Chain A, The Crystal Structure Of The Spinach Plastoc... 80 3e-13 sp|P00298.1|PLAS_RUMOB RecName: Full=Plastocyanin 80 3e-13 sp|P00290.1|PLAS_LACSA RecName: Full=Plastocyanin gi|229615|prf|... 80 3e-13 prf||0512260A plastocyanin 80 3e-13 pdb|2PCF|A Chain A, The Complex Of Cytochrome F And Plastocyanin... 80 3e-13 sp|P00289.2|PLAS_SPIOL RecName: Full=Plastocyanin, chloroplastic... 80 3e-13 >sp|P35477.1|PLAS2_TOBAC RecName: Full=Plastocyanin B'/B'' gi|544647|gb|AAB29409.1| a-plastocyanin, PCa(I) [Nicotiana tabacum=tobacco, var. Virginia, whole leaves, Peptide, 99 aa] Length = 99 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLNGPGETYSVTLSEKG+YTFYC+PHQGAGMVG VTVN Sbjct: 58 SEEDLLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99 >gb|EXB81496.1| Plastocyanin [Morus notabilis] Length = 165 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLNGPGE+YSVTL+EKGSY FYCSPHQGAGMVG VTVN Sbjct: 124 SEEDLLNGPGESYSVTLTEKGSYAFYCSPHQGAGMVGKVTVN 165 >sp|P35476.1|PLAS1_TOBAC RecName: Full=Plastocyanin A'/A'' gi|544646|gb|AAB29408.1| b-plastocyanin, PCb(II) [Nicotiana tabacum=tobacco, var. Virginia, whole leaves, Peptide, 99 aa] Length = 99 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEE+ LNGPGETYSVTLSEKG+YTFYC+PHQGAGMVG VTVN Sbjct: 58 SEEEYLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99 >ref|WP_017428787.1| hypothetical protein, partial [Vibrio vulnificus] Length = 94 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTV 124 SEEDLLN PGETYSVTL+EKGSYTFYCSPHQGAGMVG VTV Sbjct: 53 SEEDLLNAPGETYSVTLTEKGSYTFYCSPHQGAGMVGKVTV 93 >ref|XP_002510603.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis] gi|223551304|gb|EEF52790.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis] Length = 168 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLNGPGETY+VTL+EKG+Y+FYC+PHQGAGMVG VTVN Sbjct: 127 SEEDLLNGPGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 168 >sp|P00297.1|PLAS_SOLCR RecName: Full=Plastocyanin gi|223147|prf||0512261A plastocyanin Length = 99 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 5 EEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 EEDLLN PGETYSVTLSEKG+Y+FYCSPHQGAGMVG VTVN Sbjct: 59 EEDLLNAPGETYSVTLSEKGTYSFYCSPHQGAGMVGKVTVN 99 >gb|ABG81099.1| b-plastocyanin [Pelargonium x hortorum] Length = 53 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEED LNGPGETY+VTLSEKG+Y+FYC+PHQGAGMVG VTVN Sbjct: 12 SEEDYLNGPGETYAVTLSEKGTYSFYCAPHQGAGMVGKVTVN 53 >ref|XP_006435266.1| hypothetical protein CICLE_v10002698mg [Citrus clementina] gi|568839506|ref|XP_006473724.1| PREDICTED: plastocyanin, chloroplastic-like [Citrus sinensis] gi|557537388|gb|ESR48506.1| hypothetical protein CICLE_v10002698mg [Citrus clementina] Length = 168 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 S EDLLNGPGETY+VTL+EKG+Y+FYCSPHQGAGMVG VTVN Sbjct: 127 STEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168 >ref|XP_004291323.1| PREDICTED: plastocyanin, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 167 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETYSVTL+EKG+Y+FYCSPHQGAGM G VTVN Sbjct: 126 SEEDLLNAPGETYSVTLTEKGTYSFYCSPHQGAGMAGKVTVN 167 >ref|XP_004238398.1| PREDICTED: plastocyanin, chloroplastic [Solanum lycopersicum] gi|130271|sp|P17340.1|PLAS_SOLLC RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor gi|19300|emb|CAA32121.1| unnamed protein product [Solanum lycopersicum] Length = 170 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN GETYSVTLSEKG+YTFYC+PHQGAGMVG VTVN Sbjct: 129 SEEDLLNAAGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 170 >ref|XP_002285904.1| PREDICTED: plastocyanin, chloroplastic isoform 1 [Vitis vinifera] gi|359491972|ref|XP_003634348.1| PREDICTED: plastocyanin, chloroplastic isoform 2 [Vitis vinifera] gi|302141707|emb|CBI18910.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGE YSVTL+EKG+Y+FYCSPHQGAGMVG VTVN Sbjct: 127 SEEDLLNAPGEVYSVTLTEKGTYSFYCSPHQGAGMVGKVTVN 168 >emb|CAN64704.1| hypothetical protein VITISV_038998 [Vitis vinifera] Length = 168 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGE YSVTL+EKG+Y+FYCSPHQGAGMVG VTVN Sbjct: 127 SEEDLLNAPGEVYSVTLTEKGTYSFYCSPHQGAGMVGKVTVN 168 >gb|AAR85968.1| ERT10 [Nicotiana tabacum] Length = 106 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTV 124 SEE+ LNGPGETYSVTLSEKG+YTFYC+PHQGAGMVG VTV Sbjct: 66 SEEEYLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTV 106 >pdb|1AG6|A Chain A, Plastocyanin From Spinach Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETY VTL+EKG+Y FYCSPHQGAGMVG VTVN Sbjct: 58 SEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 99 >pdb|1OOW|A Chain A, The Crystal Structure Of The Spinach Plastocyanin Double Mutant G8dL12E GIVES INSIGHT INTO ITS LOW REACTIVITY Towards Photosystem 1 And Cytochrome F Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETY VTL+EKG+Y FYCSPHQGAGMVG VTVN Sbjct: 58 SEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 99 >sp|P00298.1|PLAS_RUMOB RecName: Full=Plastocyanin Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTV 124 SEEDLLN PGETY+VTLSEKG+Y+FYCSPHQGAGMVG VTV Sbjct: 58 SEEDLLNAPGETYAVTLSEKGTYSFYCSPHQGAGMVGKVTV 98 >sp|P00290.1|PLAS_LACSA RecName: Full=Plastocyanin gi|229615|prf||765954A plastocyanin Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETY+VTL+EKG+Y+FYC+PHQGAGMVG VTVN Sbjct: 58 SEEDLLNAPGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 99 >prf||0512260A plastocyanin Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTV 124 SEEDLLN PGETY+VTLSEKG+Y+FYCSPHQGAGMVG VTV Sbjct: 58 SEEDLLNAPGETYAVTLSEKGTYSFYCSPHQGAGMVGKVTV 98 >pdb|2PCF|A Chain A, The Complex Of Cytochrome F And Plastocyanin Determined With Paramagnetic Nmr. Based On The Structures Of Cytochrome F And Plastocyanin, 10 Structures gi|62738655|pdb|1YLB|B Chain B, Nmr Solution Structure Of The Reduced Spinach Plastocyanin Length = 99 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETY VTL+EKG+Y FYCSPHQGAGMVG VTVN Sbjct: 58 SEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 99 >sp|P00289.2|PLAS_SPIOL RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor gi|21267|emb|CAA28398.1| unnamed protein product [Spinacia oleracea] Length = 168 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 SEEDLLNGPGETYSVTLSEKGSYTFYCSPHQGAGMVGTVTVN 127 SEEDLLN PGETY VTL+EKG+Y FYCSPHQGAGMVG VTVN Sbjct: 127 SEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 168