BLASTX nr result
ID: Sinomenium21_contig00011087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00011087 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158872.1| PREDICTED: WD repeat-containing protein 82-B... 57 4e-06 ref|XP_004134865.1| PREDICTED: WD repeat-containing protein 82-B... 57 4e-06 gb|EYU30799.1| hypothetical protein MIMGU_mgv1a009748mg [Mimulus... 56 5e-06 gb|EXC35364.1| WD repeat-containing protein 82-B [Morus notabilis] 56 5e-06 emb|CBI17381.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002268226.1| PREDICTED: WD repeat-containing protein 82-B... 56 5e-06 emb|CAN80813.1| hypothetical protein VITISV_020464 [Vitis vinifera] 56 5e-06 >ref|XP_004158872.1| PREDICTED: WD repeat-containing protein 82-B-like [Cucumis sativus] Length = 332 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/41 (73%), Positives = 31/41 (75%), Gaps = 5/41 (12%) Frame = -3 Query: 110 LTLSISFCSW-----AGSGDGSVYAWSVRSGKEVASWMSTE 3 LTL SF +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 253 LTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSTE 293 >ref|XP_004134865.1| PREDICTED: WD repeat-containing protein 82-B-like [Cucumis sativus] Length = 332 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/41 (73%), Positives = 31/41 (75%), Gaps = 5/41 (12%) Frame = -3 Query: 110 LTLSISFCSW-----AGSGDGSVYAWSVRSGKEVASWMSTE 3 LTL SF +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 253 LTLEASFSPEGMFVISGSGDGSVYAWSVRSGKEVASWMSTE 293 >gb|EYU30799.1| hypothetical protein MIMGU_mgv1a009748mg [Mimulus guttatus] Length = 332 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 80 AGSGDGSVYAWSVRSGKEVASWMSTE 3 +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 268 SGSGDGSVYAWSVRSGKEVASWMSTE 293 >gb|EXC35364.1| WD repeat-containing protein 82-B [Morus notabilis] Length = 333 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 80 AGSGDGSVYAWSVRSGKEVASWMSTE 3 +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 269 SGSGDGSVYAWSVRSGKEVASWMSTE 294 >emb|CBI17381.3| unnamed protein product [Vitis vinifera] Length = 522 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 80 AGSGDGSVYAWSVRSGKEVASWMSTE 3 +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 458 SGSGDGSVYAWSVRSGKEVASWMSTE 483 >ref|XP_002268226.1| PREDICTED: WD repeat-containing protein 82-B-like [Vitis vinifera] Length = 334 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 80 AGSGDGSVYAWSVRSGKEVASWMSTE 3 +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 270 SGSGDGSVYAWSVRSGKEVASWMSTE 295 >emb|CAN80813.1| hypothetical protein VITISV_020464 [Vitis vinifera] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 80 AGSGDGSVYAWSVRSGKEVASWMSTE 3 +GSGDGSVYAWSVRSGKEVASWMSTE Sbjct: 264 SGSGDGSVYAWSVRSGKEVASWMSTE 289