BLASTX nr result
ID: Sinomenium21_contig00010837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00010837 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214674.1| hypothetical protein PRUPE_ppa021862mg [Prun... 55 8e-06 >ref|XP_007214674.1| hypothetical protein PRUPE_ppa021862mg [Prunus persica] gi|462410539|gb|EMJ15873.1| hypothetical protein PRUPE_ppa021862mg [Prunus persica] Length = 410 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/90 (37%), Positives = 47/90 (52%), Gaps = 13/90 (14%) Frame = +1 Query: 169 MDLLRSAYSTGSDEEDDEKNLVQQRPP-------AKRFRSENP------SNGLRPISHFS 309 MDLL +AYS SD E++E+ +Q P +KR + NP N L + F Sbjct: 1 MDLLCNAYSNASDNEEEEEESAKQPRPENFTPPNSKRLKPVNPFTHTKTQNPLSGSTQFP 60 Query: 310 NQRKEDPIPGRYVSKRERAALATSSDSISP 399 + E P+PGRYVSKRER+ L + + P Sbjct: 61 ARHIEAPVPGRYVSKRERSLLGSQPTASDP 90