BLASTX nr result
ID: Sinomenium21_contig00010508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00010508 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276334.1| PREDICTED: probable calcium-binding protein ... 55 4e-10 >ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera] Length = 222 Score = 55.1 bits (131), Expect(2) = 4e-10 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -1 Query: 133 TPTSVLLTKSMEISSADLSDFSSDIHYELVEAFKRLDKDGDGRI 2 TPTSVL S EIS D SDFSSDI ELV AFK +D+DGDG+I Sbjct: 58 TPTSVLPMHSYEISG-DWSDFSSDIQTELVHAFKMIDRDGDGKI 100 Score = 34.7 bits (78), Expect(2) = 4e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 213 MKLIKNLNPKQIFRSRKSRS 154 MKLI +NPKQ+FRS+KSRS Sbjct: 1 MKLIYKINPKQLFRSKKSRS 20