BLASTX nr result
ID: Sinomenium21_contig00010430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00010430 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469851.1| PREDICTED: diacylglycerol kinase 5-like [Cit... 59 9e-07 gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus... 58 1e-06 ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 1e-06 ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 1e-06 ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 1e-06 ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phas... 58 1e-06 ref|XP_002319931.2| hypothetical protein POPTR_0013s14470g [Popu... 58 1e-06 ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [... 58 1e-06 gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] 58 2e-06 gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus... 58 2e-06 ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 2e-06 ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 2e-06 ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 2e-06 gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopers... 58 2e-06 gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopers... 58 2e-06 gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopers... 58 2e-06 ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [So... 58 2e-06 ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isof... 58 2e-06 ref|XP_006841856.1| hypothetical protein AMTR_s00003p00271270 [A... 57 2e-06 ref|XP_007132623.1| hypothetical protein PHAVU_011G110600g [Phas... 57 3e-06 >ref|XP_006469851.1| PREDICTED: diacylglycerol kinase 5-like [Citrus sinensis] Length = 227 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -2 Query: 250 FAYIC-SIRSIVCLNLPSFSGGLNPWGTPN 164 F++ C SIRSIVCLNLPSFSGGLNPWGTPN Sbjct: 15 FSFFCNSIRSIVCLNLPSFSGGLNPWGTPN 44 >gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Mimulus guttatus] Length = 489 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 314 SIRSIVCLNLPSFSGGLNPWGTPNSN 339 >ref|XP_006365995.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] gi|565400983|ref|XP_006365996.1| PREDICTED: diacylglycerol kinase 5-like isoform X4 [Solanum tuberosum] Length = 493 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 317 SIRSIVCLNLPSFSGGLNPWGTPNSN 342 >ref|XP_006365994.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 500 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 324 SIRSIVCLNLPSFSGGLNPWGTPNSN 349 >ref|XP_006365993.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 502 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 326 SIRSIVCLNLPSFSGGLNPWGTPNSN 351 >ref|XP_007149903.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] gi|561023167|gb|ESW21897.1| hypothetical protein PHAVU_005G108700g [Phaseolus vulgaris] Length = 423 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPNK+ Sbjct: 315 SIRSIVCLNLPSFSGGLNPWGTPNKH 340 >ref|XP_002319931.2| hypothetical protein POPTR_0013s14470g [Populus trichocarpa] gi|550325844|gb|EEE95854.2| hypothetical protein POPTR_0013s14470g [Populus trichocarpa] Length = 493 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 318 SIRSIVCLNLPSFSGGLNPWGTPNSN 343 >ref|XP_004248144.1| PREDICTED: diacylglycerol kinase iota-like [Solanum lycopersicum] Length = 493 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 317 SIRSIVCLNLPSFSGGLNPWGTPNSN 342 >gb|AHW50676.1| diacylglycerol kinase [Nicotiana tabacum] Length = 493 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 319 SVRSIVCLNLPSFSGGLNPWGTPNNN 344 >gb|EYU26096.1| hypothetical protein MIMGU_mgv1a005244mg [Mimulus guttatus] Length = 492 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 SIRSIVCLNLPSFSGGLNPWGTPN N Sbjct: 318 SIRSIVCLNLPSFSGGLNPWGTPNTN 343 >ref|XP_006357549.1| PREDICTED: diacylglycerol kinase 5-like isoform X3 [Solanum tuberosum] Length = 544 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 348 SVRSIVCLNLPSFSGGLNPWGTPNSN 373 >ref|XP_006357548.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Solanum tuberosum] Length = 489 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSN 340 >ref|XP_006357547.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Solanum tuberosum] Length = 522 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 348 SVRSIVCLNLPSFSGGLNPWGTPNSN 373 >gb|AAG23130.1| diacylglycerol kinase variant A [Solanum lycopersicum] Length = 489 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSN 340 >gb|AAG23129.1|AF198259_1 diacylglycerol kinase [Solanum lycopersicum] Length = 489 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSN 340 >gb|AAG23131.1| diacylglycerol kinase variant B [Solanum lycopersicum] Length = 511 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSN 340 >ref|NP_001234476.1| calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] gi|10798890|gb|AAG23128.1|AF198258_1 calmodulin-binding diacylglycerol kinase [Solanum lycopersicum] Length = 511 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNKN 158 S+RSIVCLNLPSFSGGLNPWGTPN N Sbjct: 315 SVRSIVCLNLPSFSGGLNPWGTPNSN 340 >ref|XP_003540337.1| PREDICTED: diacylglycerol kinase 5-like isoform X1 [Glycine max] gi|571494383|ref|XP_006592834.1| PREDICTED: diacylglycerol kinase 5-like isoform X2 [Glycine max] Length = 488 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNK 161 SIRSIVCLNLPSFSGGLNPWGTPNK Sbjct: 314 SIRSIVCLNLPSFSGGLNPWGTPNK 338 >ref|XP_006841856.1| hypothetical protein AMTR_s00003p00271270 [Amborella trichopoda] gi|548843877|gb|ERN03531.1| hypothetical protein AMTR_s00003p00271270 [Amborella trichopoda] Length = 489 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNK 161 SIRSI+CLNLPSFSGGLNPWGTPNK Sbjct: 312 SIRSIICLNLPSFSGGLNPWGTPNK 336 >ref|XP_007132623.1| hypothetical protein PHAVU_011G110600g [Phaseolus vulgaris] gi|561005623|gb|ESW04617.1| hypothetical protein PHAVU_011G110600g [Phaseolus vulgaris] Length = 481 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 235 SIRSIVCLNLPSFSGGLNPWGTPNK 161 SIRSIVCLNLPSFSGGLNPWGTPN+ Sbjct: 308 SIRSIVCLNLPSFSGGLNPWGTPNR 332