BLASTX nr result
ID: Sinomenium21_contig00010395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00010395 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1... 70 4e-10 ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 ... 70 4e-10 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 ... 69 7e-10 ref|XP_006378154.1| porin family protein [Populus trichocarpa] g... 69 9e-10 ref|XP_002312708.1| porin family protein [Populus trichocarpa] g... 69 9e-10 gb|AAQ87021.1| VDAC1.3 [Lotus japonicus] 69 9e-10 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 68 1e-09 ref|NP_001275134.1| mitochondrial outer membrane protein porin o... 68 1e-09 ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane prot... 68 1e-09 ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citr... 68 1e-09 ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane prot... 68 1e-09 ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 67 2e-09 emb|CBI32017.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane prot... 67 3e-09 ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane prot... 67 3e-09 ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prun... 66 4e-09 gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca] 66 4e-09 ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane prot... 66 4e-09 gb|ACU19720.1| unknown [Glycine max] 66 4e-09 ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma... 66 6e-09 >ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial [Theobroma cacao] gi|508710157|gb|EOY02054.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial [Theobroma cacao] Length = 224 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 116 QILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 ++ TT+TVDEP PGLKTIF+FV+PDQ+SGKVELQYQH+ Sbjct: 103 KLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHE 140 >ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao] gi|508710156|gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao] Length = 276 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 116 QILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 ++ TT+TVDEP PGLKTIF+FV+PDQ+SGKVELQYQH+ Sbjct: 76 KLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHE 113 >gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis] Length = 276 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 +LTTITVDEP PGLK IF+F++PDQ+SGKVELQYQH+ Sbjct: 77 LLTTITVDEPAPGLKAIFSFIVPDQRSGKVELQYQHE 113 >ref|XP_006378154.1| porin family protein [Populus trichocarpa] gi|118481103|gb|ABK92505.1| unknown [Populus trichocarpa] gi|550329024|gb|ERP55951.1| porin family protein [Populus trichocarpa] Length = 276 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 +LTTIT+DEP PGLKTIF+F +PDQ+SGKVELQYQH+ Sbjct: 77 LLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHE 113 >ref|XP_002312708.1| porin family protein [Populus trichocarpa] gi|118484777|gb|ABK94257.1| unknown [Populus trichocarpa] gi|222852528|gb|EEE90075.1| porin family protein [Populus trichocarpa] Length = 276 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 +LTTIT+DEP PGLKTIF+F +PDQ+SGKVELQYQH+ Sbjct: 77 LLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHE 113 >gb|AAQ87021.1| VDAC1.3 [Lotus japonicus] Length = 276 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 107 TTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 TTITVDEP PGLKTIF+F+ PDQKSGKVELQYQH+ Sbjct: 79 TTITVDEPAPGLKTIFSFIFPDQKSGKVELQYQHE 113 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+FV+PDQKSGKVELQY H+ Sbjct: 77 VYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHE 113 >ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum tuberosum] gi|1172556|sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+FV+PDQKSGKVELQY H+ Sbjct: 77 VYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHE 113 >ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Citrus sinensis] Length = 276 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLK+IF+F++PDQ+SGKVELQYQH+ Sbjct: 77 LFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHE 113 >ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] gi|557540816|gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] Length = 276 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLK+IF+F++PDQ+SGKVELQYQH+ Sbjct: 77 LFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHE 113 >ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Solanum lycopersicum] Length = 276 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+FV+PDQKSGKVELQY H+ Sbjct: 77 LYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHE 113 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+F IPDQ+SGKVELQYQH+ Sbjct: 77 VSTTITVDEPAPGLKTIFSFKIPDQRSGKVELQYQHE 113 >emb|CBI32017.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+F+IPDQ+SGKVELQY H+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHE 113 >ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa isoform 1 [Vitis vinifera] Length = 276 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+F+IPDQ+SGKVELQY H+ Sbjct: 77 LFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHE 113 >ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Cicer arietinum] Length = 276 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 +LTTITVDEP PGLKTIF+F+ PDQ S KVELQYQH+ Sbjct: 77 LLTTITVDEPAPGLKTIFSFIFPDQNSAKVELQYQHE 113 >ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica] gi|462419297|gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica] Length = 344 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 107 TTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 TTIT+DEP PGLK IF+F++PDQ+SGKVELQYQH+ Sbjct: 147 TTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHE 181 >gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 107 TTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 TTIT+DEP PGLK IF+F++PDQ+SGKVELQYQH+ Sbjct: 79 TTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHE 113 >ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Glycine max] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 107 TTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 TTITVDEP PGLKTIF+F PDQKSGKVELQYQH+ Sbjct: 79 TTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHE 113 >gb|ACU19720.1| unknown [Glycine max] Length = 241 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 107 TTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 TTITVDEP PGLKTIF+F PDQKSGKVELQYQH+ Sbjct: 79 TTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHE 113 >ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao] gi|508711479|gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao] Length = 276 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 113 ILTTITVDEPTPGLKTIFNFVIPDQKSGKVELQYQHD 3 + TTITVDEP PGLKTIF+F +PDQ+SGKVELQY HD Sbjct: 77 LFTTITVDEPAPGLKTIFSFRVPDQRSGKVELQYLHD 113