BLASTX nr result
ID: Sinomenium21_contig00010161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00010161 (900 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830416.1| hypothetical protein AMTR_s00118p00074890 [A... 57 1e-05 >ref|XP_006830416.1| hypothetical protein AMTR_s00118p00074890 [Amborella trichopoda] gi|548836750|gb|ERM97832.1| hypothetical protein AMTR_s00118p00074890 [Amborella trichopoda] Length = 411 Score = 57.0 bits (136), Expect = 1e-05 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 777 VRRRAGDMEKLASRALDTDTPVMVQIQELLRGVKDAVSLAQ 899 V++ G KLA RAL+TDTPVMVQIQEL+RGV A+SLAQ Sbjct: 11 VQKAMGSCSKLAKRALETDTPVMVQIQELVRGVNGAISLAQ 51