BLASTX nr result
ID: Sinomenium21_contig00009153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00009153 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273793.1| PREDICTED: protoporphyrinogen oxidase, chlor... 70 3e-10 emb|CAN69262.1| hypothetical protein VITISV_004031 [Vitis vinifera] 70 3e-10 ref|XP_004289439.1| PREDICTED: protoporphyrinogen oxidase, chlor... 69 5e-10 ref|XP_007051313.1| Flavin containing amine oxidoreductase famil... 68 1e-09 gb|AAD02290.1| protoporphyrinogen oxidase PX-1 [Nicotiana tabacum] 68 1e-09 sp|O24163.1|PPOC_TOBAC RecName: Full=Protoporphyrinogen oxidase,... 68 1e-09 dbj|BAA34713.1| plastidal protoporphyrinogen oxidase [Nicotiana ... 68 1e-09 gb|EXB44471.1| Protoporphyrinogen oxidase [Morus notabilis] 68 1e-09 ref|XP_004229365.1| PREDICTED: protoporphyrinogen oxidase, chlor... 68 1e-09 ref|NP_001275224.1| protoporphyrinogen oxidase, chloroplastic-li... 68 1e-09 ref|XP_003536005.1| PREDICTED: protoporphyrinogen oxidase 1, chl... 68 1e-09 ref|XP_002874964.1| hypothetical protein ARALYDRAFT_912062 [Arab... 68 1e-09 gb|AAC72870.1| Arabidopsis thaliana protoporphyrinogen oxidase p... 67 2e-09 ref|NP_192078.1| protoporphyrinogen oxidase [Arabidopsis thalian... 67 2e-09 ref|XP_007145088.1| hypothetical protein PHAVU_007G208700g [Phas... 67 2e-09 ref|XP_004967639.1| PREDICTED: protoporphyrinogen oxidase, chlor... 67 2e-09 ref|XP_004495854.1| PREDICTED: protoporphyrinogen oxidase, chlor... 67 2e-09 gb|EMT07463.1| Protoporphyrinogen oxidase, chloroplastic [Aegilo... 67 2e-09 ref|NP_001105564.1| protoporphyrinogen IX oxidase (plastidic)1 [... 67 2e-09 gb|AAK62389.1|AF386944_1 Unknown protein [Arabidopsis thaliana] 67 2e-09 >ref|XP_002273793.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic [Vitis vinifera] gi|297744080|emb|CBI37050.3| unnamed protein product [Vitis vinifera] Length = 549 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +G+FLGGNYVSGVALGRCVEGAYE AAE + FLS YVYK Sbjct: 511 QGMFLGGNYVSGVALGRCVEGAYEVAAEVADFLSQYVYK 549 >emb|CAN69262.1| hypothetical protein VITISV_004031 [Vitis vinifera] Length = 549 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +G+FLGGNYVSGVALGRCVEGAYE AAE + FLS YVYK Sbjct: 511 QGMFLGGNYVSGVALGRCVEGAYEVAAEVADFLSQYVYK 549 >ref|XP_004289439.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 547 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYVSGVALGRCVEGAY+ AA+ +KFLS Y YK Sbjct: 509 QGLFLGGNYVSGVALGRCVEGAYDIAADVAKFLSQYAYK 547 >ref|XP_007051313.1| Flavin containing amine oxidoreductase family [Theobroma cacao] gi|508703574|gb|EOX95470.1| Flavin containing amine oxidoreductase family [Theobroma cacao] Length = 539 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +3 Query: 6 GLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 GLFLGGNYVSGVALGRCVEGAYE AAE FLS Y YK Sbjct: 502 GLFLGGNYVSGVALGRCVEGAYEVAAEVKDFLSQYAYK 539 >gb|AAD02290.1| protoporphyrinogen oxidase PX-1 [Nicotiana tabacum] Length = 548 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYVSGVALGRCVEGAYE A+E + FLS Y YK Sbjct: 510 EGLFLGGNYVSGVALGRCVEGAYEVASEVTGFLSRYAYK 548 >sp|O24163.1|PPOC_TOBAC RecName: Full=Protoporphyrinogen oxidase, chloroplastic; Short=PPO; AltName: Full=Protoporphyrinogen IX oxidase isozyme I; Short=PPO I; Short=PPX I; Flags: Precursor gi|2370333|emb|CAA73865.1| protoporphyrinogen oxidase [Nicotiana tabacum] Length = 548 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYVSGVALGRCVEGAYE A+E + FLS Y YK Sbjct: 510 EGLFLGGNYVSGVALGRCVEGAYEVASEVTGFLSRYAYK 548 >dbj|BAA34713.1| plastidal protoporphyrinogen oxidase [Nicotiana tabacum] Length = 548 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYVSGVALGRCVEGAYE A+E + FLS Y YK Sbjct: 510 EGLFLGGNYVSGVALGRCVEGAYEVASEVTGFLSRYAYK 548 >gb|EXB44471.1| Protoporphyrinogen oxidase [Morus notabilis] Length = 546 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYVSGVALGRCVEGAY+ AAE + FLS Y YK Sbjct: 508 QGLFLGGNYVSGVALGRCVEGAYDVAAEVASFLSQYSYK 546 >ref|XP_004229365.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic-like [Solanum lycopersicum] Length = 558 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYVSGVALGRCVEGAYE A+E + FLS Y YK Sbjct: 520 DGLFLGGNYVSGVALGRCVEGAYEIASEVTGFLSQYAYK 558 >ref|NP_001275224.1| protoporphyrinogen oxidase, chloroplastic-like [Solanum tuberosum] gi|3093410|emb|CAA12400.1| protoporphyrinogen oxidase [Solanum tuberosum] Length = 557 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYVSGVALGRCVEGAYE A+E + FLS Y YK Sbjct: 519 DGLFLGGNYVSGVALGRCVEGAYEIASEVTGFLSQYAYK 557 >ref|XP_003536005.1| PREDICTED: protoporphyrinogen oxidase 1, chloroplastic [Glycine max] Length = 543 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYVSGVALGRCVEGAYE AAE + FL++ VYK Sbjct: 505 EGLFLGGNYVSGVALGRCVEGAYEVAAEVNDFLTNRVYK 543 >ref|XP_002874964.1| hypothetical protein ARALYDRAFT_912062 [Arabidopsis lyrata subsp. lyrata] gi|297320801|gb|EFH51223.1| hypothetical protein ARALYDRAFT_912062 [Arabidopsis lyrata subsp. lyrata] Length = 539 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYV+GVALGRCVEGAYE+A E + F+S Y YK Sbjct: 499 EGLFLGGNYVAGVALGRCVEGAYETATEVNNFMSRYAYK 537 >gb|AAC72870.1| Arabidopsis thaliana protoporphyrinogen oxidase precursor (PPO) (SW:P55826) [Arabidopsis thaliana] Length = 545 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYV+GVALGRCVEGAYE+A E + F+S Y YK Sbjct: 507 EGLFLGGNYVAGVALGRCVEGAYETAIEVNNFMSRYAYK 545 >ref|NP_192078.1| protoporphyrinogen oxidase [Arabidopsis thaliana] gi|2495184|sp|P55826.1|PPOC_ARATH RecName: Full=Protoporphyrinogen oxidase 1, chloroplastic; Short=PPO1; Flags: Precursor gi|1877018|dbj|BAA11820.1| protoporphyrinogen oxidase [Arabidopsis thaliana] gi|7268212|emb|CAB77739.1| protoporphyrinogen oxidase [Arabidopsis thaliana] gi|56550711|gb|AAV97809.1| At4g01690 [Arabidopsis thaliana] gi|58331767|gb|AAW70381.1| At4g01690 [Arabidopsis thaliana] gi|332656665|gb|AEE82065.1| protoporphyrinogen oxidase [Arabidopsis thaliana] Length = 537 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYV+GVALGRCVEGAYE+A E + F+S Y YK Sbjct: 499 EGLFLGGNYVAGVALGRCVEGAYETAIEVNNFMSRYAYK 537 >ref|XP_007145088.1| hypothetical protein PHAVU_007G208700g [Phaseolus vulgaris] gi|561018278|gb|ESW17082.1| hypothetical protein PHAVU_007G208700g [Phaseolus vulgaris] Length = 543 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYVSGVALGRCVEGAYE+AAE + +L+ VYK Sbjct: 505 EGLFLGGNYVSGVALGRCVEGAYEAAAEVNDYLTSRVYK 543 >ref|XP_004967639.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic-like [Setaria italica] Length = 535 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYV+GVALGRCVEGAYESA++ S FL+ Y YK Sbjct: 497 DGLFLGGNYVAGVALGRCVEGAYESASQISDFLTKYAYK 535 >ref|XP_004495854.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic-like [Cicer arietinum] Length = 558 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYV+GVALGRCVEGAYE AAE + FLS VYK Sbjct: 520 EGLFLGGNYVTGVALGRCVEGAYEVAAEVNDFLSQRVYK 558 >gb|EMT07463.1| Protoporphyrinogen oxidase, chloroplastic [Aegilops tauschii] Length = 559 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYV+GVALGRC+EGAYESA++ S FL+ Y YK Sbjct: 521 DGLFLGGNYVAGVALGRCIEGAYESASQVSDFLTKYAYK 559 >ref|NP_001105564.1| protoporphyrinogen IX oxidase (plastidic)1 [Zea mays] gi|6715441|gb|AAF26417.1|AF218052_1 protoporphyrinogen IX oxidase [Zea mays] Length = 535 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 +GLFLGGNYV+GVALGRCVEGAYESA++ S FL+ Y YK Sbjct: 497 DGLFLGGNYVAGVALGRCVEGAYESASQISDFLTKYAYK 535 >gb|AAK62389.1|AF386944_1 Unknown protein [Arabidopsis thaliana] Length = 537 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 EGLFLGGNYVSGVALGRCVEGAYESAAEASKFLSDYVYK 119 EGLFLGGNYV+GVALGRCVEGAYE+A E + F+S Y YK Sbjct: 499 EGLFLGGNYVAGVALGRCVEGAYETAIEVNNFMSRYAYK 537