BLASTX nr result
ID: Sinomenium21_contig00008678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00008678 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019598.1| S18 ribosomal protein [Theobroma cacao] gi|5... 100 2e-19 ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [C... 100 2e-19 gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] 100 2e-19 ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus... 100 2e-19 ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus... 100 2e-19 emb|CBI28706.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocar... 100 4e-19 gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] 99 5e-19 gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] 99 5e-19 ref|XP_007225841.1| hypothetical protein PRUPE_ppa011659mg [Prun... 99 5e-19 emb|CBI18243.3| unnamed protein product [Vitis vinifera] 99 5e-19 gb|ACS96445.1| S18.A ribosomal protein [Jatropha curcas] 99 5e-19 ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18-like [V... 99 5e-19 gb|ACM90157.1| S18 ribosomal protein [Jatropha curcas] 99 5e-19 ref|XP_002306780.1| hypothetical protein POPTR_0005s23280g [Popu... 99 5e-19 ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [A... 99 6e-19 ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycin... 99 6e-19 ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citr... 99 8e-19 ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citr... 99 8e-19 ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycin... 99 8e-19 >ref|XP_007019598.1| S18 ribosomal protein [Theobroma cacao] gi|590601179|ref|XP_007019599.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|590601183|ref|XP_007019600.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724926|gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724927|gb|EOY16824.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724928|gb|EOY16825.1| S18 ribosomal protein isoform 1 [Theobroma cacao] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223540104|gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|313586541|gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223536431|gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis] Length = 152 Score = 100 bits (250), Expect = 2e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >emb|CBI28706.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 100 bits (249), Expect = 2e-19 Identities = 50/61 (81%), Positives = 55/61 (90%) Frame = +1 Query: 103 RVRESLQRSPIMSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD 282 ++R + + MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD Sbjct: 750 QLRRASSETLTMSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKAD 809 Query: 283 V 285 V Sbjct: 810 V 810 >ref|XP_002307515.1| 40S ribosomal protein S18 [Populus trichocarpa] gi|222856964|gb|EEE94511.1| 40S ribosomal protein S18 [Populus trichocarpa] Length = 152 Score = 99.8 bits (247), Expect = 4e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRF+NIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFSNIVCKKADV 50 >gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] Length = 152 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] Length = 225 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLV NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 74 MSLVTNEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 123 >ref|XP_007225841.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica] gi|462422777|gb|EMJ27040.1| hypothetical protein PRUPE_ppa011659mg [Prunus persica] Length = 202 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 51 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 100 >emb|CBI18243.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 43 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 92 >gb|ACS96445.1| S18.A ribosomal protein [Jatropha curcas] Length = 152 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|225460586|ref|XP_002262702.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|359479621|ref|XP_003632303.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] Length = 152 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >gb|ACM90157.1| S18 ribosomal protein [Jatropha curcas] Length = 152 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_002306780.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa] gi|118481499|gb|ABK92692.1| unknown [Populus trichocarpa] gi|222856229|gb|EEE93776.1| hypothetical protein POPTR_0005s23280g [Populus trichocarpa] Length = 152 Score = 99.4 bits (246), Expect = 5e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 50 >ref|XP_006844400.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] gi|548846846|gb|ERN06075.1| hypothetical protein AMTR_s00142p00099380 [Amborella trichopoda] Length = 152 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSL+ANEDFQHILRVLNTNVDG+QKIMFALTSIKGIGRRFANIVCKKAD+ Sbjct: 1 MSLIANEDFQHILRVLNTNVDGRQKIMFALTSIKGIGRRFANIVCKKADI 50 >ref|XP_006574786.1| PREDICTED: 40S ribosomal protein S18 [Glycine max] Length = 152 Score = 99.0 bits (245), Expect = 6e-19 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANI CKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANICCKKADV 50 >ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] gi|568838213|ref|XP_006473109.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557536642|gb|ESR47760.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] Length = 152 Score = 98.6 bits (244), Expect = 8e-19 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADV 50 >ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] gi|568872460|ref|XP_006489386.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557521804|gb|ESR33171.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] Length = 152 Score = 98.6 bits (244), Expect = 8e-19 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADV 50 >ref|NP_001236608.1| uncharacterized protein LOC100500087 [Glycine max] gi|255629053|gb|ACU14871.1| unknown [Glycine max] Length = 152 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +1 Query: 136 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADV 285 MSLVANEDFQHILRVLNTNVDGKQKIMFA+TSIKGIGRRFANI CKKADV Sbjct: 1 MSLVANEDFQHILRVLNTNVDGKQKIMFAMTSIKGIGRRFANIACKKADV 50