BLASTX nr result
ID: Sinomenium21_contig00008586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00008586 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308309.2| hypothetical protein POPTR_0006s15900g [Popu... 58 1e-06 gb|EXC11898.1| hypothetical protein L484_005359 [Morus notabilis] 57 3e-06 ref|XP_004287349.1| PREDICTED: nudix hydrolase 19, chloroplastic... 55 8e-06 >ref|XP_002308309.2| hypothetical protein POPTR_0006s15900g [Populus trichocarpa] gi|550336433|gb|EEE91832.2| hypothetical protein POPTR_0006s15900g [Populus trichocarpa] Length = 407 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 168 INMQAHAFAGNPLRSKAPKPGHSLSPDAALETLKTLLL 281 I++Q+HAFAGNPLRSK P+P H LSP ALETLKT L+ Sbjct: 3 ISLQSHAFAGNPLRSKTPQPTHPLSPALALETLKTQLV 40 >gb|EXC11898.1| hypothetical protein L484_005359 [Morus notabilis] Length = 211 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 165 IINMQAHAFAGNPLRSKAPKPGHSLSPDAALETLKTLLL 281 +IN+Q+HAF GNPL SK PK GH SP ALE +KT LL Sbjct: 53 VINLQSHAFTGNPLHSKTPKSGHPFSPSQALEAVKTCLL 91 >ref|XP_004287349.1| PREDICTED: nudix hydrolase 19, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 443 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +3 Query: 153 PFMSIINMQAHAFAGNPLRSKAPKPGHSLSPDAALETLKTLLL 281 P IN+Q+HAFAGNPLRSK PK SP ALETLKT LL Sbjct: 35 PTTMSINLQSHAFAGNPLRSKTPKLSDPFSPTQALETLKTQLL 77